Clone RE57452 Report

Search the DGRC for RE57452

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:574
Well:52
Vector:pFlc-1
Associated Gene/TranscriptCpr11A-RA
Protein status:RE57452.pep: gold
Preliminary Size:893
Sequenced Size:1340

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2560 2001-12-14 Blastp of sequenced clone
CG2560 2002-01-01 Sim4 clustering to Release 2
CG2560 2003-01-01 Sim4 clustering to Release 3
Cpr11A 2008-04-29 Release 5.5 accounting
Cpr11A 2008-08-15 Release 5.9 accounting
Cpr11A 2008-12-18 5.12 accounting

Clone Sequence Records

RE57452.complete Sequence

1340 bp (1340 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071531

> RE57452.complete
CGGTATTTATTTGCTAGAATCTGTGAGCATCGGAACTAACCGAGCCGCTA
CAATAAAAAAAAAAAAACATAAATTAGTCCTCGTTACGAAAAAAAAAACA
CACATAAAAATGAAGAGTTTTCTGATCCTTCTGGGTTTCGCTGCTCTGGC
CGCTGCCGATGTCAAGCATCTGACAGATCGCAATCTGGACCTCTTCAAGT
ACAATCCCAGCGATATCTACACCCTGCCCGAGGACATCGATGACGACAAG
CCGGCGGTGCACTTTAGCGGCGATGTCATGAAGGCCAAGACCGAAACCCT
CCAGAACTACAACTCGGGCAAGAAATTCAAGCTGGAACTGAAGACCCAGA
ACGGCATCGAAGTGAGCAGCGTGGGCAAACTGAAGGACGACAAGACCTTC
GTGGTCAGCGGCTCCTACTCGTTCACCGGCGCCGATGGCAAGCGGTACAA
GACCCGTTACACCGCCGATGAGTTCGGCTATCATCCCATCACCGAGCTGG
ATCTGGACATTCCCGAACCCCAGCCTTTGGCTTCTGCCGGACAGCGCCAG
ACCGTGGATCCCAGCAGCCTGTTGGGCAACAAGAACCGTTTCCAGTTCCT
GCAGCAGACCCTGGACTCCGATCAAGGATCGCAAGGTCCTCTGAGGGGCA
GTGGACAGAGTGGCGATGACTATAGCTACACGTCTCCCTATGGAAATGGC
AATGCTTACGGTAATGGAGTTGGAAACGGATACGGAAATGGAGTTGGCAA
CGGATACGGAAATGGAGTTGGAAACGGACAAGGAAATGGAGCTGGAAACG
CATACGGAAATGGAAATGGAGTTGGAAACGGATACGGAAATGGCAACGGC
AATGGCTACGATTATCAGCCACCTCAGGTGCCCCTGGCGACGCCATCTCG
TCTGTATCTGCCCACCGCATAAGGCGATTATTATTTAGATATACCCTTAT
CCAACACCCTTCTCCCGCAAGATTTATGCCCCACCCGATTCCCGATTCCT
GATTCCCGATTCCCGATTCCCGATCCTCGATTTTCCCCCCAGCTGCAAGT
ATTTAGTTTTTAAGTGCAACTCCAACAGGCAAATGAAGAGTAAAACAGAG
CTAGCGAAATTTTTTTTTATCATTTTTTAGTGTTATACACGGAGCACAAT
TTTATATGATATTATACACTGATATATGTTATATATCTAGCCTACACAAA
AACACGCACACACACACACAAAAAAAACAAACACACACACAAATCCCGAG
CAAAGACACAAACGAATCTATGTATATACACTGAGTGATATTAGTAGTAA
ATAAAATGGCTAAACTAACGATCTAAAAAAAAAAAAAAAA

RE57452.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr11A-RA 1327 Cpr11A-RA 3..1323 3..1323 6605 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 12379606..12380420 517..1323 3810 98.4 Plus
chrX 22417052 chrX 12378791..12379005 122..336 1075 100 Plus
chrX 22417052 chrX 12379282..12379461 337..516 885 99.4 Plus
chrX 22417052 chrX 12377941..12378059 3..121 595 100 Plus
chrX 22417052 chrX 12379796..12379908 731..843 295 84.1 Plus
chrX 22417052 chrX 12379820..12379932 707..819 295 84.1 Plus
chrX 22417052 chrX 12379779..12379855 738..814 220 85.7 Plus
chrX 22417052 chrX 12379827..12379903 690..766 220 85.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:05:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 12488642..12489448 517..1323 4035 100 Plus
X 23542271 X 12487827..12488041 122..336 1075 100 Plus
X 23542271 X 12488317..12488496 337..516 900 100 Plus
X 23542271 X 12486975..12487093 3..121 595 100 Plus
X 23542271 X 12488856..12488968 707..819 295 84.1 Plus
X 23542271 X 12488832..12488944 731..843 295 84.1 Plus
X 23542271 X 12488815..12488891 738..814 220 85.7 Plus
X 23542271 X 12488863..12488939 690..766 220 85.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 12496740..12497546 517..1323 4035 100 Plus
X 23527363 X 12495925..12496139 122..336 1075 100 Plus
X 23527363 X 12496415..12496594 337..516 900 100 Plus
X 23527363 X 12495073..12495191 3..121 595 100 Plus
Blast to na_te.dros performed 2019-03-15 19:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 4063..4151 753..665 130 60.7 Minus

RE57452.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:59:42 Download gff for RE57452.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 12377939..12378059 1..121 98 -> Plus
chrX 12378791..12379005 122..336 100 -> Plus
chrX 12379282..12379461 337..516 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:25:39 Download gff for RE57452.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11A-RA 1..813 110..922 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:08:24 Download gff for RE57452.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11A-RA 1..813 110..922 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:01:42 Download gff for RE57452.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11A-RA 1..813 110..922 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:32:41 Download gff for RE57452.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11A-RA 1..813 110..922 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:27:19 Download gff for RE57452.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11A-RA 1..813 110..922 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:37:23 Download gff for RE57452.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11A-RA 3..1323 3..1324 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:24 Download gff for RE57452.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11A-RA 3..1323 3..1324 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:01:42 Download gff for RE57452.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11A-RA 4..1326 1..1323 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:41 Download gff for RE57452.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11A-RA 3..1323 3..1324 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:27:19 Download gff for RE57452.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr11A-RA 4..1326 1..1323 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:59:42 Download gff for RE57452.complete
Subject Subject Range Query Range Percent Splice Strand
X 12487827..12488041 122..336 100 -> Plus
X 12488317..12488496 337..516 100 -> Plus
X 12486973..12487093 1..121 98 -> Plus
X 12488642..12489448 517..1324 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:59:42 Download gff for RE57452.complete
Subject Subject Range Query Range Percent Splice Strand
X 12487827..12488041 122..336 100 -> Plus
X 12488317..12488496 337..516 100 -> Plus
X 12486973..12487093 1..121 98 -> Plus
X 12488642..12489448 517..1324 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:59:42 Download gff for RE57452.complete
Subject Subject Range Query Range Percent Splice Strand
X 12487827..12488041 122..336 100 -> Plus
X 12488317..12488496 337..516 100 -> Plus
X 12486973..12487093 1..121 98 -> Plus
X 12488642..12489448 517..1324 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:01:42 Download gff for RE57452.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 12381006..12381126 1..121 98 -> Plus
arm_X 12381860..12382074 122..336 100 -> Plus
arm_X 12382350..12382529 337..516 100 -> Plus
arm_X 12382675..12383481 517..1324 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:09:36 Download gff for RE57452.complete
Subject Subject Range Query Range Percent Splice Strand
X 12495925..12496139 122..336 100 -> Plus
X 12496415..12496594 337..516 100 -> Plus
X 12496740..12497546 517..1324 99   Plus
X 12495071..12495191 1..121 98 -> Plus

RE57452.hyp Sequence

Translation from 0 to 921

> RE57452.hyp
CIYLLESVSIGTNRAATIKKKKHKLVLVTKKKTHIKMKSFLILLGFAALA
AADVKHLTDRNLDLFKYNPSDIYTLPEDIDDDKPAVHFSGDVMKAKTETL
QNYNSGKKFKLELKTQNGIEVSSVGKLKDDKTFVVSGSYSFTGADGKRYK
TRYTADEFGYHPITELDLDIPEPQPLASAGQRQTVDPSSLLGNKNRFQFL
QQTLDSDQGSQGPLRGSGQSGDDYSYTSPYGNGNAYGNGVGNGYGNGVGN
GYGNGVGNGQGNGAGNAYGNGNGVGNGYGNGNGNGYDYQPPQVPLATPSR
LYLPTA*

RE57452.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:13:10
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr11A-PA 270 CG2560-PA 1..270 37..306 1444 100 Plus
Cpr47Ef-PD 601 CG13214-PD 141..318 102..285 207 33.9 Plus
Cpr47Ef-PC 612 CG13214-PC 141..318 102..285 207 33.9 Plus
Cpr65Au-PB 106 CG18778-PB 22..100 89..162 148 38 Plus
Cpr65Au-PA 106 CG18778-PA 22..100 89..162 148 38 Plus

RE57452.pep Sequence

Translation from 109 to 921

> RE57452.pep
MKSFLILLGFAALAAADVKHLTDRNLDLFKYNPSDIYTLPEDIDDDKPAV
HFSGDVMKAKTETLQNYNSGKKFKLELKTQNGIEVSSVGKLKDDKTFVVS
GSYSFTGADGKRYKTRYTADEFGYHPITELDLDIPEPQPLASAGQRQTVD
PSSLLGNKNRFQFLQQTLDSDQGSQGPLRGSGQSGDDYSYTSPYGNGNAY
GNGVGNGYGNGVGNGYGNGVGNGQGNGAGNAYGNGNGVGNGYGNGNGNGY
DYQPPQVPLATPSRLYLPTA*

RE57452.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21926-PA 243 GF21926-PA 1..243 1..270 994 77.4 Plus
Dana\GF10924-PA 106 GF10924-PA 22..100 53..126 143 38 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17723-PA 216 GG17723-PA 1..216 1..270 1015 77.4 Plus
Dere\GG14084-PA 106 GG14084-PA 22..100 53..126 141 38 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24125-PA 220 GH24125-PA 2..220 3..270 890 69.4 Plus
Dgri\GH21539-PA 91 GH21539-PA 12..86 49..126 151 43.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr11A-PA 270 CG2560-PA 1..270 1..270 1444 100 Plus
Cpr47Ef-PD 601 CG13214-PD 141..318 66..249 207 33.9 Plus
Cpr47Ef-PC 612 CG13214-PC 141..318 66..249 207 33.9 Plus
AnxB11-PG 511 CG9968-PG 128..189 191..254 155 46.9 Plus
AnxB11-PE 511 CG9968-PE 128..189 191..254 155 46.9 Plus
AnxB11-PB 511 CG9968-PB 128..189 191..254 155 46.9 Plus
AnxB11-PG 511 CG9968-PG 120..189 187..258 153 43.1 Plus
AnxB11-PE 511 CG9968-PE 120..189 187..258 153 43.1 Plus
AnxB11-PB 511 CG9968-PB 120..189 187..258 153 43.1 Plus
Cpr65Au-PB 106 CG18778-PB 22..100 53..126 148 38 Plus
Cpr65Au-PA 106 CG18778-PA 22..100 53..126 148 38 Plus
Fst-PA 286 CG9434-PA 29..123 173..262 148 38.9 Plus
CG9106-PB 143 CG9106-PB 8..81 192..265 144 45.3 Plus
CG9106-PA 143 CG9106-PA 8..81 192..265 144 45.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16383-PA 234 GI16383-PA 1..234 1..270 846 71.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25331-PA 280 GL25331-PA 18..280 17..270 875 70.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15394-PA 272 GA15394-PA 18..272 17..270 882 80.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11567-PA 236 GM11567-PA 1..236 1..270 1166 86.3 Plus
Dsec\GM13867-PA 106 GM13867-PA 22..100 53..126 139 38 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17081-PA 236 GD17081-PA 1..236 1..270 1170 87.4 Plus
Dsim\GD13152-PA 106 GD13152-PA 22..100 53..126 140 38 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16756-PA 246 GJ16756-PA 1..246 1..270 953 76.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16498-PA 262 GK16498-PA 1..262 1..270 986 76.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:02:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17013-PA 219 GE17013-PA 1..219 1..270 1048 79.6 Plus
Dyak\GE20509-PA 106 GE20509-PA 22..100 53..126 142 38 Plus