Clone RE57564 Report

Search the DGRC for RE57564

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:575
Well:64
Vector:pFlc-1
Associated Gene/TranscriptCG4866-RA
Protein status:RE57564.pep: gold
Preliminary Size:634
Sequenced Size:664

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4866 2001-12-14 Blastp of sequenced clone
CG4866 2002-01-01 Sim4 clustering to Release 2
CG4866 2003-01-01 Sim4 clustering to Release 3
CG4866 2008-04-29 Release 5.5 accounting
CG4866 2008-08-15 Release 5.9 accounting
CG4866 2008-12-18 5.12 accounting

Clone Sequence Records

RE57564.complete Sequence

664 bp (664 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071534

> RE57564.complete
AATTTGCAAAATAATATAAATAAAAATGGTTCGTAAACTCAAATTTCATG
AGCAGAAGCTGCTTAAAAAGGTGGACTTCATCACCTGGAAAGTGGACAAC
GGCGGCAAGGAGAACAAAATCCTTAGGCGCTTTCACATTCAAAAAAGGGA
GGACTACACCAAGTATAACAAGTTGTCCAGGGAGATACGGGAACTGGCAG
AGAGGATAGCTAAGCTGGATGCTTCAGAACCTTTCAAGACGGAGGCCACC
ACCATGCTCCTAAACAAGCTGCACGCCATGGGAGTTTCCAATGATCAGCT
TACTTTGGAAACGGCGGCCAAGATATCTGCCAGCCACTTTTGCCGACGTC
GTCTACCCGTGATCATGGTGAAACTTCGAATGTCGGAGCACCTGAAAGCG
GCCACAGACCTCATAGAGCATGGTCATGTGCGTGTTGGTCCGGAAATGAT
TAAGGATCCTGCTTTTCTGGTCTCCAGAAACCTCGAGGACTTTGTCACCT
GGGTGGATGGCTCCAAGATCAAGGAGCATGTACTCCGCTACAACGACATG
CGTGACGATTTCCAAATGTAGAGAGACTACCTCCCTTAAGATAACCAGTA
GAGTAACTAAAGCTAACTTGCAATAAAACCAACTAAGACTTTGTTAAACA
AAAAAAAAAAAAAA

RE57564.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG4866-RA 885 CG4866-RA 45..692 1..648 3240 100 Plus
CG4866-RB 884 CG4866-RB 44..691 1..648 3240 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13405824..13406095 377..648 1345 99.6 Plus
chr2R 21145070 chr2R 13405554..13405765 163..374 1000 98.1 Plus
chr2R 21145070 chr2R 13405336..13405500 1..165 795 98.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:05:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17518753..17519026 375..648 1370 100 Plus
2R 25286936 2R 17518484..17518695 163..374 1060 100 Plus
2R 25286936 2R 17518266..17518430 1..165 825 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17519952..17520225 375..648 1370 100 Plus
2R 25260384 2R 17519683..17519894 163..374 1060 100 Plus
2R 25260384 2R 17519465..17519629 1..165 825 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:33:05 has no hits.

RE57564.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:34:14 Download gff for RE57564.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13405364..13405497 29..162 98 -> Plus
chr2R 13405554..13405765 163..374 98 -> Plus
chr2R 13405822..13406095 375..649 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:25:46 Download gff for RE57564.complete
Subject Subject Range Query Range Percent Splice Strand
CG4866-RA 1..546 26..571 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:07:09 Download gff for RE57564.complete
Subject Subject Range Query Range Percent Splice Strand
CG4866-RB 1..546 26..571 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:21:06 Download gff for RE57564.complete
Subject Subject Range Query Range Percent Splice Strand
CG4866-RA 1..546 26..571 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:31:32 Download gff for RE57564.complete
Subject Subject Range Query Range Percent Splice Strand
CG4866-RA 1..546 26..571 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:14:53 Download gff for RE57564.complete
Subject Subject Range Query Range Percent Splice Strand
CG4866-RA 1..546 26..571 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:35:40 Download gff for RE57564.complete
Subject Subject Range Query Range Percent Splice Strand
CG4866-RA 1..642 1..642 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:07:08 Download gff for RE57564.complete
Subject Subject Range Query Range Percent Splice Strand
CG4866-RB 44..691 1..649 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:21:06 Download gff for RE57564.complete
Subject Subject Range Query Range Percent Splice Strand
CG4866-RA 44..691 1..649 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:31:33 Download gff for RE57564.complete
Subject Subject Range Query Range Percent Splice Strand
CG4866-RA 1..642 1..642 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:14:53 Download gff for RE57564.complete
Subject Subject Range Query Range Percent Splice Strand
CG4866-RA 44..691 1..649 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:34:14 Download gff for RE57564.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17518266..17518427 1..162 100 -> Plus
2R 17518484..17518695 163..374 100 -> Plus
2R 17518753..17519026 375..649 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:34:14 Download gff for RE57564.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17518266..17518427 1..162 100 -> Plus
2R 17518484..17518695 163..374 100 -> Plus
2R 17518753..17519026 375..649 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:34:14 Download gff for RE57564.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17518266..17518427 1..162 100 -> Plus
2R 17518484..17518695 163..374 100 -> Plus
2R 17518753..17519026 375..649 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:21:06 Download gff for RE57564.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13405771..13405932 1..162 100 -> Plus
arm_2R 13405989..13406200 163..374 100 -> Plus
arm_2R 13406258..13406531 375..649 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:08:10 Download gff for RE57564.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17519683..17519894 163..374 100 -> Plus
2R 17519952..17520225 375..649 99   Plus
2R 17519465..17519626 1..162 100 -> Plus

RE57564.pep Sequence

Translation from 25 to 570

> RE57564.pep
MVRKLKFHEQKLLKKVDFITWKVDNGGKENKILRRFHIQKREDYTKYNKL
SREIRELAERIAKLDASEPFKTEATTMLLNKLHAMGVSNDQLTLETAAKI
SASHFCRRRLPVIMVKLRMSEHLKAATDLIEHGHVRVGPEMIKDPAFLVS
RNLEDFVTWVDGSKIKEHVLRYNDMRDDFQM*

RE57564.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:55:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13134-PA 181 GF13134-PA 1..181 1..181 922 95 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20692-PA 181 GG20692-PA 1..181 1..181 949 98.9 Plus
Dere\GG21790-PA 181 GG21790-PA 1..181 1..181 946 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21413-PA 181 GH21413-PA 1..181 1..181 854 85.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG4866-PA 181 CG4866-PA 1..181 1..181 932 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18589-PA 181 GI18589-PA 1..181 1..181 849 84.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11436-PA 181 GL11436-PA 1..181 1..181 910 93.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18489-PA 181 GA18489-PA 1..181 1..181 910 93.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21792-PA 181 GM21792-PA 1..181 1..181 947 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11283-PA 181 GD11283-PA 1..181 1..181 954 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20387-PA 181 GJ20387-PA 1..181 1..181 849 84.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22911-PA 181 GK22911-PA 1..181 1..181 880 89 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11866-PA 181 GE11866-PA 1..181 1..181 954 99.4 Plus
Dyak\GE11676-PA 181 GE11676-PA 1..181 1..181 945 98.3 Plus

RE57564.hyp Sequence

Translation from 25 to 570

> RE57564.hyp
MVRKLKFHEQKLLKKVDFITWKVDNGGKENKILRRFHIQKREDYTKYNKL
SREIRELAERIAKLDASEPFKTEATTMLLNKLHAMGVSNDQLTLETAAKI
SASHFCRRRLPVIMVKLRMSEHLKAATDLIEHGHVRVGPEMIKDPAFLVS
RNLEDFVTWVDGSKIKEHVLRYNDMRDDFQM*

RE57564.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG4866-PA 181 CG4866-PA 1..181 1..181 932 100 Plus