BDGP Sequence Production Resources |
Search the DGRC for RE57564
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 575 |
Well: | 64 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG4866-RA |
Protein status: | RE57564.pep: gold |
Preliminary Size: | 634 |
Sequenced Size: | 664 |
Gene | Date | Evidence |
---|---|---|
CG4866 | 2001-12-14 | Blastp of sequenced clone |
CG4866 | 2002-01-01 | Sim4 clustering to Release 2 |
CG4866 | 2003-01-01 | Sim4 clustering to Release 3 |
CG4866 | 2008-04-29 | Release 5.5 accounting |
CG4866 | 2008-08-15 | Release 5.9 accounting |
CG4866 | 2008-12-18 | 5.12 accounting |
664 bp (664 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071534
> RE57564.complete AATTTGCAAAATAATATAAATAAAAATGGTTCGTAAACTCAAATTTCATG AGCAGAAGCTGCTTAAAAAGGTGGACTTCATCACCTGGAAAGTGGACAAC GGCGGCAAGGAGAACAAAATCCTTAGGCGCTTTCACATTCAAAAAAGGGA GGACTACACCAAGTATAACAAGTTGTCCAGGGAGATACGGGAACTGGCAG AGAGGATAGCTAAGCTGGATGCTTCAGAACCTTTCAAGACGGAGGCCACC ACCATGCTCCTAAACAAGCTGCACGCCATGGGAGTTTCCAATGATCAGCT TACTTTGGAAACGGCGGCCAAGATATCTGCCAGCCACTTTTGCCGACGTC GTCTACCCGTGATCATGGTGAAACTTCGAATGTCGGAGCACCTGAAAGCG GCCACAGACCTCATAGAGCATGGTCATGTGCGTGTTGGTCCGGAAATGAT TAAGGATCCTGCTTTTCTGGTCTCCAGAAACCTCGAGGACTTTGTCACCT GGGTGGATGGCTCCAAGATCAAGGAGCATGTACTCCGCTACAACGACATG CGTGACGATTTCCAAATGTAGAGAGACTACCTCCCTTAAGATAACCAGTA GAGTAACTAAAGCTAACTTGCAATAAAACCAACTAAGACTTTGTTAAACA AAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 13405824..13406095 | 377..648 | 1345 | 99.6 | Plus |
chr2R | 21145070 | chr2R | 13405554..13405765 | 163..374 | 1000 | 98.1 | Plus |
chr2R | 21145070 | chr2R | 13405336..13405500 | 1..165 | 795 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 17518753..17519026 | 375..648 | 1370 | 100 | Plus |
2R | 25286936 | 2R | 17518484..17518695 | 163..374 | 1060 | 100 | Plus |
2R | 25286936 | 2R | 17518266..17518430 | 1..165 | 825 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 17519952..17520225 | 375..648 | 1370 | 100 | Plus |
2R | 25260384 | 2R | 17519683..17519894 | 163..374 | 1060 | 100 | Plus |
2R | 25260384 | 2R | 17519465..17519629 | 1..165 | 825 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 13405364..13405497 | 29..162 | 98 | -> | Plus |
chr2R | 13405554..13405765 | 163..374 | 98 | -> | Plus |
chr2R | 13405822..13406095 | 375..649 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4866-RA | 1..546 | 26..571 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4866-RB | 1..546 | 26..571 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4866-RA | 1..546 | 26..571 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4866-RA | 1..546 | 26..571 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4866-RA | 1..546 | 26..571 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4866-RA | 1..642 | 1..642 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4866-RB | 44..691 | 1..649 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4866-RA | 44..691 | 1..649 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4866-RA | 1..642 | 1..642 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4866-RA | 44..691 | 1..649 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17518266..17518427 | 1..162 | 100 | -> | Plus |
2R | 17518484..17518695 | 163..374 | 100 | -> | Plus |
2R | 17518753..17519026 | 375..649 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17518266..17518427 | 1..162 | 100 | -> | Plus |
2R | 17518484..17518695 | 163..374 | 100 | -> | Plus |
2R | 17518753..17519026 | 375..649 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17518266..17518427 | 1..162 | 100 | -> | Plus |
2R | 17518484..17518695 | 163..374 | 100 | -> | Plus |
2R | 17518753..17519026 | 375..649 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 13405771..13405932 | 1..162 | 100 | -> | Plus |
arm_2R | 13405989..13406200 | 163..374 | 100 | -> | Plus |
arm_2R | 13406258..13406531 | 375..649 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17519683..17519894 | 163..374 | 100 | -> | Plus |
2R | 17519952..17520225 | 375..649 | 99 | Plus | |
2R | 17519465..17519626 | 1..162 | 100 | -> | Plus |
Translation from 25 to 570
> RE57564.pep MVRKLKFHEQKLLKKVDFITWKVDNGGKENKILRRFHIQKREDYTKYNKL SREIRELAERIAKLDASEPFKTEATTMLLNKLHAMGVSNDQLTLETAAKI SASHFCRRRLPVIMVKLRMSEHLKAATDLIEHGHVRVGPEMIKDPAFLVS RNLEDFVTWVDGSKIKEHVLRYNDMRDDFQM*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13134-PA | 181 | GF13134-PA | 1..181 | 1..181 | 922 | 95 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20692-PA | 181 | GG20692-PA | 1..181 | 1..181 | 949 | 98.9 | Plus |
Dere\GG21790-PA | 181 | GG21790-PA | 1..181 | 1..181 | 946 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21413-PA | 181 | GH21413-PA | 1..181 | 1..181 | 854 | 85.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG4866-PA | 181 | CG4866-PA | 1..181 | 1..181 | 932 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18589-PA | 181 | GI18589-PA | 1..181 | 1..181 | 849 | 84.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11436-PA | 181 | GL11436-PA | 1..181 | 1..181 | 910 | 93.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18489-PA | 181 | GA18489-PA | 1..181 | 1..181 | 910 | 93.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21792-PA | 181 | GM21792-PA | 1..181 | 1..181 | 947 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11283-PA | 181 | GD11283-PA | 1..181 | 1..181 | 954 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20387-PA | 181 | GJ20387-PA | 1..181 | 1..181 | 849 | 84.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22911-PA | 181 | GK22911-PA | 1..181 | 1..181 | 880 | 89 | Plus |
Translation from 25 to 570
> RE57564.hyp MVRKLKFHEQKLLKKVDFITWKVDNGGKENKILRRFHIQKREDYTKYNKL SREIRELAERIAKLDASEPFKTEATTMLLNKLHAMGVSNDQLTLETAAKI SASHFCRRRLPVIMVKLRMSEHLKAATDLIEHGHVRVGPEMIKDPAFLVS RNLEDFVTWVDGSKIKEHVLRYNDMRDDFQM*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG4866-PA | 181 | CG4866-PA | 1..181 | 1..181 | 932 | 100 | Plus |