Clone RE57663 Report

Search the DGRC for RE57663

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:576
Well:63
Vector:pFlc-1
Associated Gene/TranscriptCG7272-RA
Protein status:RE57663.pep: gold
Preliminary Size:1038
Sequenced Size:1215

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7272 2001-12-17 Blastp of sequenced clone
CG7272 2002-01-01 Sim4 clustering to Release 2
CG7272 2003-01-01 Sim4 clustering to Release 3
CG7272 2008-04-29 Release 5.5 accounting
CG7272 2008-08-15 Release 5.9 accounting
CG7272 2008-12-18 5.12 accounting

Clone Sequence Records

RE57663.complete Sequence

1215 bp (1215 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071536

> RE57663.complete
GCTCAGTATTTGTTCGTTTGTTGTTACGGCAGCCGCCAGTCGGTCGTTAG
TTTTTGTTTTCGTTCATTTGTTTATACTCGCGCGGCACTCGGCCCCCCTC
CCGTTCCCACATAACCCGTTTGAAAGGCATCAACTGAGAGTCATTGAAAT
CATGGAGGCACTGGGGGATCTCTTGGCGCCACACAGCGAACTAATCGCCA
AGGTAGCCGGCACCATAACTACCCTGCAATTTCTGTCCGGAGTGGTTCTG
ATGAACGACATCCGCAAGAAGGGTAGCAGCGACGTCTACCCGGTGGGCCC
ATTTCTCTTCGGAGTGGTGCTGACCGTTCTCAGCTTGAAGCTGGCCAACA
TTATGAATGATGCTGCCATGATCAATACGAATTTAATCGGCCTGGTGATA
AACTTCGTCTTCCTCTTCGGATTTTACTACTACGCCTCGAGCGCCAGCAG
GAGCAAGATCTGGAAGCAGATTGGCTATTCCTCGGTGTTCCTATTGGCCA
TCACCGCGTATGCCAACTTCGAGGATCCCGCCAAGATTGAGTTCCGCCTG
GGAATGCTGATCACCGGCATCCTGGTTTGGATGGTGGGCTCTCCCCTGCT
GCATCTGCCGAAAATCATTGAGAAGAAGAGCACCGAGGGAATGCCGTTCC
CGATTATCTTTGCCGGTAATCTGGTGGCATTTTCCTGGACGCTGTATGCC
ATCTCCATCAAGAATACTGTGATGGTGCTGCAGAACCTTTTGCTGCTGGT
CCTGGGCGGCATTCAGCTCTCCATGTTCGCTATTTATCCCAACAAACCGG
CTGCCGAGAAGCCCAAGGACAGCAAGAAGGACAAATAATTGAAATCGAAC
GCTTTACCTAGAAAAAAGGACAAATAATGGGTTGTTGCAACAACATTACC
AAGTAATAAGTAGCTAGGCTTTGAGGAATAATCAAATTATTGCTTGAATT
TACACTAAACCGCCACAAGAAAACTAAATTTGAGCTAAACGAATTATTTT
TCTATATAGGAAATATTTTCTTAGAACAAATCCAGCTAACTAAGTTGCTA
GCTAACCTAGAATTGTTATTATATTGACTATTATTGTATATAACTACTAC
ATACTTGCAATTTTTGACAATAATTCAAATCTTCCAAATGCATACGTATT
TATAAAGTCAACATAATATGTAATAAAACAATCTGTTACAAAAAAAAAAA
AAAAAAAAAAAAAAA

RE57663.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG7272-RA 1238 CG7272-RA 45..1237 1..1193 5965 100 Plus
CG7272.b 1183 CG7272.b 1..1183 1..1189 5830 99.4 Plus
CG7272.a 1070 CG7272.a 203..1070 322..1189 4340 100 Plus
CG7272.a 1070 CG7272.a 1..203 1..203 1015 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15493259..15493721 727..1189 2315 100 Plus
chr3L 24539361 chr3L 15492789..15493194 322..727 2030 100 Plus
chr3L 24539361 chr3L 15490892..15491213 1..322 1610 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:05:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:32:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15503307..15503773 727..1193 2335 100 Plus
3L 28110227 3L 15502837..15503242 322..727 2030 100 Plus
3L 28110227 3L 15500940..15501261 1..322 1610 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15496407..15496873 727..1193 2335 100 Plus
3L 28103327 3L 15495937..15496342 322..727 2030 100 Plus
3L 28103327 3L 15494040..15494361 1..322 1610 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:32:41 has no hits.

RE57663.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:33:47 Download gff for RE57663.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15490892..15491212 1..321 100 -> Plus
chr3L 15492789..15493194 322..727 100 -> Plus
chr3L 15493260..15493721 728..1189 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:25:50 Download gff for RE57663.complete
Subject Subject Range Query Range Percent Splice Strand
CG7272-RA 1..687 152..838 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:58:51 Download gff for RE57663.complete
Subject Subject Range Query Range Percent Splice Strand
CG7272-RA 1..687 152..838 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:04:43 Download gff for RE57663.complete
Subject Subject Range Query Range Percent Splice Strand
CG7272-RA 1..687 152..838 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:23:36 Download gff for RE57663.complete
Subject Subject Range Query Range Percent Splice Strand
CG7272-RA 1..687 152..838 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:41:24 Download gff for RE57663.complete
Subject Subject Range Query Range Percent Splice Strand
CG7272-RA 1..687 152..838 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:24:09 Download gff for RE57663.complete
Subject Subject Range Query Range Percent Splice Strand
CG7272-RA 1..1189 1..1189 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:58:51 Download gff for RE57663.complete
Subject Subject Range Query Range Percent Splice Strand
CG7272-RA 1..1189 1..1189 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:04:43 Download gff for RE57663.complete
Subject Subject Range Query Range Percent Splice Strand
CG7272-RA 3..1191 1..1189 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:23:36 Download gff for RE57663.complete
Subject Subject Range Query Range Percent Splice Strand
CG7272-RA 1..1189 1..1189 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:41:24 Download gff for RE57663.complete
Subject Subject Range Query Range Percent Splice Strand
CG7272-RA 3..1191 1..1189 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:47 Download gff for RE57663.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15500940..15501260 1..321 100 -> Plus
3L 15502837..15503242 322..727 100 -> Plus
3L 15503308..15503769 728..1189 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:47 Download gff for RE57663.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15500940..15501260 1..321 100 -> Plus
3L 15502837..15503242 322..727 100 -> Plus
3L 15503308..15503769 728..1189 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:47 Download gff for RE57663.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15500940..15501260 1..321 100 -> Plus
3L 15502837..15503242 322..727 100 -> Plus
3L 15503308..15503769 728..1189 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:04:43 Download gff for RE57663.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15494040..15494360 1..321 100 -> Plus
arm_3L 15495937..15496342 322..727 100 -> Plus
arm_3L 15496408..15496869 728..1189 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:58:40 Download gff for RE57663.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15494040..15494360 1..321 100 -> Plus
3L 15495937..15496342 322..727 100 -> Plus
3L 15496408..15496869 728..1189 100   Plus

RE57663.hyp Sequence

Translation from 0 to 837

> RE57663.hyp
LSICSFVVTAAASRSLVFVFVHLFILARHSAPLPFPHNPFERHQLRVIEI
MEALGDLLAPHSELIAKVAGTITTLQFLSGVVLMNDIRKKGSSDVYPVGP
FLFGVVLTVLSLKLANIMNDAAMINTNLIGLVINFVFLFGFYYYASSASR
SKIWKQIGYSSVFLLAITAYANFEDPAKIEFRLGMLITGILVWMVGSPLL
HLPKIIEKKSTEGMPFPIIFAGNLVAFSWTLYAISIKNTVMVLQNLLLLV
LGGIQLSMFAIYPNKPAAEKPKDSKKDK*

RE57663.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG7272-PA 228 CG7272-PA 1..228 51..278 1144 100 Plus
slv-PC 226 CG8717-PC 6..208 61..263 212 27.2 Plus
slv-PB 226 CG8717-PB 6..208 61..263 212 27.2 Plus
slv-PA 226 CG8717-PA 6..208 61..263 212 27.2 Plus

RE57663.pep Sequence

Translation from 151 to 837

> RE57663.pep
MEALGDLLAPHSELIAKVAGTITTLQFLSGVVLMNDIRKKGSSDVYPVGP
FLFGVVLTVLSLKLANIMNDAAMINTNLIGLVINFVFLFGFYYYASSASR
SKIWKQIGYSSVFLLAITAYANFEDPAKIEFRLGMLITGILVWMVGSPLL
HLPKIIEKKSTEGMPFPIIFAGNLVAFSWTLYAISIKNTVMVLQNLLLLV
LGGIQLSMFAIYPNKPAAEKPKDSKKDK*

RE57663.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:07:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23701-PA 228 GF23701-PA 1..218 1..218 997 89.4 Plus
Dana\GF11215-PA 226 GF11215-PA 6..210 11..215 185 27.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:07:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15900-PA 228 GG15900-PA 1..214 1..214 944 93.5 Plus
Dere\GG10680-PA 226 GG10680-PA 6..210 11..215 196 26.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:07:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13950-PA 232 GH13950-PA 1..227 1..227 810 65.2 Plus
Dgri\GH14541-PA 232 GH14541-PA 1..227 1..227 806 64.8 Plus
Dgri\GH19991-PA 225 GH19991-PA 5..209 11..215 210 27.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG7272-PA 228 CG7272-PA 1..228 1..228 1144 100 Plus
slv-PC 226 CG8717-PC 6..208 11..213 212 27.2 Plus
slv-PB 226 CG8717-PB 6..208 11..213 212 27.2 Plus
slv-PA 226 CG8717-PA 6..208 11..213 212 27.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:07:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13112-PA 230 GI13112-PA 1..220 1..221 860 74.2 Plus
Dmoj\GI20166-PA 227 GI20166-PA 5..209 11..215 191 26.6 Plus
Dmoj\GI21453-PA 219 GI21453-PA 1..207 1..217 159 24.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:07:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24812-PA 231 GL24812-PA 1..214 1..214 924 91.1 Plus
Dper\GL10598-PA 225 GL10598-PA 7..209 13..215 201 27.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:07:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20227-PA 231 GA20227-PA 1..214 1..214 924 91.1 Plus
Dpse\GA21278-PA 226 GA21278-PA 7..210 13..215 179 27.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:08:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25529-PA 228 GM25529-PA 1..228 1..228 1153 98.2 Plus
Dsec\GM20727-PA 226 GM20727-PA 6..210 11..215 197 26.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:08:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14544-PA 228 GD14544-PA 1..228 1..228 1154 98.2 Plus
Dsim\GD10194-PA 226 GD10194-PA 6..210 11..215 197 26.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13859-PA 229 GJ13859-PA 1..229 1..228 859 72.6 Plus
Dvir\GJ20230-PA 225 GJ20230-PA 5..209 11..215 181 25.1 Plus
Dvir\GJ16474-PA 220 GJ16474-PA 1..186 1..195 142 26.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20413-PA 231 GK20413-PA 1..230 1..227 963 80.9 Plus
Dwil\GK23163-PA 226 GK23163-PA 6..210 11..215 194 26.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22241-PA 228 GE22241-PA 1..228 1..228 1130 96.1 Plus
Dyak\GE23145-PA 228 GE23145-PA 1..218 1..218 998 95.9 Plus
Dyak\GE23345-PA 226 GE23345-PA 6..210 11..215 209 27.4 Plus