Clone RE57682 Report

Search the DGRC for RE57682

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:576
Well:82
Vector:pFlc-1
Associated Gene/Transcriptinsb-RA
Protein status:RE57682.pep: gold
Preliminary Size:531
Sequenced Size:866

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6520 2001-12-14 Blastp of sequenced clone
CG6520 2002-01-01 Sim4 clustering to Release 2
CG6520 2003-01-01 Sim4 clustering to Release 3
CG6520 2008-04-29 Release 5.5 accounting
CG6520 2008-08-15 Release 5.9 accounting
CG6520 2008-12-18 5.12 accounting

Clone Sequence Records

RE57682.complete Sequence

866 bp (866 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071537

> RE57682.complete
AGGTGGCGATCGCCAGGTGAACGAAGGTTGTGTCGCGCAGGAGCGAGTTG
GAAAACCAAACGATTGCAGCTTAAGTCTAGTAGATCATCCTCTAAGCATG
TCGGGCAAACTGATCATGAAGCGCAAGCGAGCCAGCCAGGAGGAGCAGCA
GCAGGCGCAGGAGCAACGTGTCCAGCCGCAGGAACAGCAACAGGAGCAGC
AACCGACTGAAGCGGTTCCGGAGAAACGCCATCGTCCTCTAACTCCACCA
GCAGAAGAGCCAGGGCAGAATTGCCCCAACCCGCCAGATGCCCCCAATCG
AATCCTTCTGGAAGCGCTGCAAAAAATAATGGAGCTGCAAGCGGAGCTGG
ATGCCTTTGAGCAGGATCTAAACGATCGAGATGGCTATGCGGCTGCCGGA
GCTGAAGCGGAGGATGTTGAGGAAAGTGACGAGGATGCCGAGGTGGCGGC
CCAGTTTGCGCCACCGACGCCAGCCCAAAGGAGTCAGGCGGAGGCACTGG
GTTTTGCCATGTGTGCCAGAGAAACATTGCTGTTTCTGCAGAGCGAGGGA
ATACCCACGGAGTCGCCACTCTACCAGACTCTCCTTGGGAAATTGGTTGG
GCAAAGCGATGGACTTCTGCACGCCTGAGAGCAAACCGGAGGGCAGGAAC
TCCTCCTCATTCTAGTCACTTTGCTGCGATCTCATTGCAAGTAAAACGAG
AGAGAGAAACCAAGGGTTGCGAACTTTCCGGGGGTGGAAATTATGCAACA
CAGGGATCTGGGTATTCCTAAGCTATTTACTCTAGTCAATTATTGTAAAG
CAATATAAAACACATAAGCAACAACGAAATAAATTATGTATATTGAAAGT
AAAAAAAAAAAAAAAA

RE57682.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG6520-RA 864 CG6520-RA 1..852 3..854 4260 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13362264..13363123 850..3 4025 98.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:05:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:25:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17475210..17476061 854..3 4260 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17476409..17477260 854..3 4260 100 Minus
Blast to na_te.dros performed 2019-03-16 19:25:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\INE-1 1467 Dbuz\INE-1 ISBU1 1467bp 169..213 796..840 108 71.1 Plus

RE57682.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:26:11 Download gff for RE57682.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13362264..13363123 1..850 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:25:51 Download gff for RE57682.complete
Subject Subject Range Query Range Percent Splice Strand
CG6520-RA 1..531 98..628 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:16 Download gff for RE57682.complete
Subject Subject Range Query Range Percent Splice Strand
CG6520-RA 1..531 98..628 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:28:47 Download gff for RE57682.complete
Subject Subject Range Query Range Percent Splice Strand
CG6520-RA 1..531 98..628 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:29:54 Download gff for RE57682.complete
Subject Subject Range Query Range Percent Splice Strand
CG6520-RA 1..531 98..628 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:31:11 Download gff for RE57682.complete
Subject Subject Range Query Range Percent Splice Strand
insb-RA 1..531 98..628 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:33:03 Download gff for RE57682.complete
Subject Subject Range Query Range Percent Splice Strand
CG6520-RA 1..848 3..850 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:16 Download gff for RE57682.complete
Subject Subject Range Query Range Percent Splice Strand
CG6520-RA 1..848 3..850 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:28:47 Download gff for RE57682.complete
Subject Subject Range Query Range Percent Splice Strand
CG6520-RA 3..854 1..850 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:29:55 Download gff for RE57682.complete
Subject Subject Range Query Range Percent Splice Strand
CG6520-RA 1..848 3..850 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:31:11 Download gff for RE57682.complete
Subject Subject Range Query Range Percent Splice Strand
insb-RA 3..854 1..850 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:26:11 Download gff for RE57682.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17475214..17476061 1..850 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:26:11 Download gff for RE57682.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17475214..17476061 1..850 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:26:11 Download gff for RE57682.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17475214..17476061 1..850 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:28:47 Download gff for RE57682.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13362719..13363566 1..850 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:06:02 Download gff for RE57682.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17476413..17477260 1..850 99   Minus

RE57682.hyp Sequence

Translation from 4 to 627

> RE57682.hyp
GDRQVNEGCVAQERVGKPNDCSLSLVDHPLSMSGKLIMKRKRASQEEQQQ
AQEQRVQPQEQQQEQQPTEAVPEKRHRPLTPPAEEPGQNCPNPPDAPNRI
LLEALQKIMELQAELDAFEQDLNDRDGYAAAGAEAEDVEESDEDAEVAAQ
FAPPTPAQRSQAEALGFAMCARETLLFLQSEGIPTESPLYQTLLGKLVGQ
SDGLLHA*

RE57682.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
insb-PB 176 CG6520-PB 1..176 32..207 899 100 Plus
insb-PA 176 CG6520-PA 1..176 32..207 899 100 Plus

RE57682.pep Sequence

Translation from 97 to 627

> RE57682.pep
MSGKLIMKRKRASQEEQQQAQEQRVQPQEQQQEQQPTEAVPEKRHRPLTP
PAEEPGQNCPNPPDAPNRILLEALQKIMELQAELDAFEQDLNDRDGYAAA
GAEAEDVEESDEDAEVAAQFAPPTPAQRSQAEALGFAMCARETLLFLQSE
GIPTESPLYQTLLGKLVGQSDGLLHA*

RE57682.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11782-PA 175 GF11782-PA 1..175 1..176 554 77.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22193-PA 181 GG22193-PA 1..181 1..176 603 83.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20484-PA 172 GH20484-PA 1..172 1..176 410 52.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
insb-PB 176 CG6520-PB 1..176 1..176 899 100 Plus
insb-PA 176 CG6520-PA 1..176 1..176 899 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21027-PA 172 GI21027-PA 1..172 1..176 456 60.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:37:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10661-PA 190 GL10661-PA 1..190 1..176 568 67.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19659-PA 189 GA19659-PA 1..189 1..176 566 68.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19979-PA 180 GM19979-PA 1..180 1..176 623 87.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25475-PA 180 GD25475-PA 1..180 1..176 843 93.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21954-PA 168 GJ21954-PA 1..168 1..176 467 62.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23299-PA 173 GK23299-PA 1..173 1..176 358 56.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14188-PA 174 GE14188-PA 1..174 1..176 574 82.7 Plus