Clone RE57705 Report

Search the DGRC for RE57705

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:577
Well:5
Vector:pFlc-1
Associated Gene/TranscriptwntD-RA
Protein status:RE57705.pep: gold
Preliminary Size:930
Sequenced Size:1163

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8458 2001-12-14 Blastp of sequenced clone
CG8458 2002-01-01 Sim4 clustering to Release 2
CG8458 2003-01-01 Sim4 clustering to Release 3
wntD 2008-04-29 Release 5.5 accounting
wntD 2008-08-15 Release 5.9 accounting
wntD 2008-12-18 5.12 accounting

Clone Sequence Records

RE57705.complete Sequence

1163 bp (1163 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071538

> RE57705.complete
ATTCAGTCGATCTAACGACATCGCAGAGATAGCACCATAACAACAATATA
AACAGACAACATGATTTTTGCCATCACATTCTTCATGGGTATTACGAGCA
CTCTGGCAGCAGTTTTGGAGCCCATGAGCTACTACCAGTACACCCAGTTC
CAGGCACCACTCTCCTGGGAGGATATAACCGGCAAGGGGCTGAAACAGGC
CCTCGACAGCTGCCAACAGAGTTTCCAGTGGCAGCGATGGAACTGTCCGA
GCCAGGATTTCGTGCAGAAGAATTCCAAGCCGGAGGAAAACTCACCAAAT
CGGGAGGATGTCTATGTGGCGGCCATTTCCATGGCAGCCATAGTCCATAC
TCTGACCAAGGACTGTGCCAATGGAGTAATCGCCGGATGCGGATGCACGG
AAAATGCTCTGAATGTACCCTGTGCCCACGAACCCACCAAGGCACTGGAG
CAGTACGAGAAGCATTTCGGATCGGGATCAGGAGCCATCGGTCACAATCG
ACGGGTGGTGGGAGCTCTACTACAAAGATCACTGGAACAGGAATGCCGGT
GCAAGCAACCAGGAGCTGTGCAGGGTGAATGCCAGGAGGAGGAGTGTGTG
GCGGTACTAAAGCCATTCGAAGCCATTGCCCAGGATCTCCTCCAAATGTA
CGACGATGCCATCCAACTAGAAGGAGCCAGTAGCAATCTAAAGATTATGT
GGCAGAACATTCCCCTAGACTCGCTGGTCTTCATGCAGGACTCGCCCAAC
TACTGCGAACGCGATGCCACCGGATTGTGGAAAGGAACACGGGGTCGCCA
GTGCTCCAAGGATGGCAGTGGTTCTCTGGAGGAACGCCTCTCCTGCCAGC
AGTTGTGCCGCGTGTGCGGATACCGAGTGAGATCCCAGCACGTGAGAACC
GAGAGGAGGTGCAATTGCAAGCTGGTCTGGGGATTCCGACTCCAGTGCGA
TGTGTGCGTCCAGCTGGAAAGGCAGTACTCCTGCTACTAAATGGATGCTC
CACTGGAAATGGAATCCAGGATTGGGGCGCTGGTCGAGTCCCACGAAAAC
TGTTTACCTACATTTAAGTTAATTTATTTGATTCCACCTCTAATTTATTA
CCACAACAAATGCTATCAATAAATACGTTATTTAACATATATCATGCAAA
AAAAAAAAAAAAA

RE57705.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
wntD-RA 1147 wntD-RA 1..1147 1..1147 5735 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9117217..9118363 1147..1 5735 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:05:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13292051..13293198 1148..1 5740 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13032882..13034029 1148..1 5740 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:57:18 has no hits.

RE57705.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:58:26 Download gff for RE57705.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9117217..9118363 1..1147 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:25:53 Download gff for RE57705.complete
Subject Subject Range Query Range Percent Splice Strand
wntD-RA 1..930 61..990 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:14:27 Download gff for RE57705.complete
Subject Subject Range Query Range Percent Splice Strand
wntD-RA 1..930 61..990 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:20:54 Download gff for RE57705.complete
Subject Subject Range Query Range Percent Splice Strand
wntD-RA 1..930 61..990 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:39:45 Download gff for RE57705.complete
Subject Subject Range Query Range Percent Splice Strand
wntD-RA 1..930 61..990 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:21:23 Download gff for RE57705.complete
Subject Subject Range Query Range Percent Splice Strand
wntD-RA 1..930 61..990 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:46:02 Download gff for RE57705.complete
Subject Subject Range Query Range Percent Splice Strand
wntD-RA 1..1147 1..1147 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:14:27 Download gff for RE57705.complete
Subject Subject Range Query Range Percent Splice Strand
wntD-RA 1..1147 1..1147 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:20:54 Download gff for RE57705.complete
Subject Subject Range Query Range Percent Splice Strand
wntD-RA 1..1147 1..1147 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:39:46 Download gff for RE57705.complete
Subject Subject Range Query Range Percent Splice Strand
wntD-RA 1..1147 1..1147 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:21:23 Download gff for RE57705.complete
Subject Subject Range Query Range Percent Splice Strand
wntD-RA 1..1147 1..1147 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:26 Download gff for RE57705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13292052..13293198 1..1147 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:26 Download gff for RE57705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13292052..13293198 1..1147 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:26 Download gff for RE57705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13292052..13293198 1..1147 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:20:54 Download gff for RE57705.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9117774..9118920 1..1147 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:16:25 Download gff for RE57705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13032883..13034029 1..1147 100   Minus

RE57705.pep Sequence

Translation from 60 to 989

> RE57705.pep
MIFAITFFMGITSTLAAVLEPMSYYQYTQFQAPLSWEDITGKGLKQALDS
CQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTK
DCANGVIAGCGCTENALNVPCAHEPTKALEQYEKHFGSGSGAIGHNRRVV
GALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDA
IQLEGASSNLKIMWQNIPLDSLVFMQDSPNYCERDATGLWKGTRGRQCSK
DGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCV
QLERQYSCY*

RE57705.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:25:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17394-PA 310 GF17394-PA 1..310 1..309 1341 79.4 Plus
Dana\GF12469-PA 352 GF12469-PA 55..351 41..308 218 27.5 Plus
Dana\GF14030-PA 544 GF14030-PA 275..543 47..308 157 23.2 Plus
Dana\GF13958-PA 149 GF13958-PA 68..148 222..308 144 35.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:25:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17065-PA 309 GG17065-PA 1..309 1..309 1636 97.7 Plus
Dere\GG24078-PA 352 GG24078-PA 55..351 41..308 210 27.8 Plus
Dere\GG23540-PA 549 GG23540-PA 280..548 47..308 164 23.6 Plus
Dere\GG18113-PA 999 GG18113-PA 857..998 162..308 160 29.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:25:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19146-PA 314 GH19146-PA 1..314 1..309 1153 67.6 Plus
Dgri\GH19925-PA 345 GH19925-PA 55..344 41..308 228 28.1 Plus
Dgri\GH13724-PA 472 GH13724-PA 83..275 42..208 150 23.5 Plus
Dgri\GH21730-PA 991 GH21730-PA 849..990 162..308 150 27.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
wntD-PA 309 CG8458-PA 1..309 1..309 1673 100 Plus
Wnt2-PB 325 CG1916-PB 28..324 41..308 273 27.3 Plus
Wnt2-PA 352 CG1916-PA 55..351 41..308 273 27.3 Plus
Wnt4-PB 539 CG4698-PB 270..538 47..308 190 24.6 Plus
Wnt4-PA 539 CG4698-PA 270..538 47..308 190 24.6 Plus
Wnt5-PB 1004 CG6407-PB 845..1003 145..308 184 27.4 Plus
Wnt5-PA 1004 CG6407-PA 845..1003 145..308 184 27.4 Plus
Wnt6-PC 420 CG4969-PC 226..419 111..308 156 24.5 Plus
Wnt6-PB 420 CG4969-PB 226..419 111..308 156 24.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23253-PA 311 GI23253-PA 22..311 20..309 1181 72.5 Plus
Dmoj\GI19882-PA 344 GI19882-PA 55..343 41..308 226 29.1 Plus
Dmoj\GI18872-PA 988 GI18872-PA 829..987 145..308 156 26.7 Plus
Dmoj\GI23655-PA 473 GI23655-PA 83..285 42..219 148 23.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23072-PA 308 GL23072-PA 1..308 1..309 1346 78.3 Plus
Dper\GL16238-PA 379 GL16238-PA 237..378 162..308 153 27.8 Plus
Dper\GL18899-PA 468 GL18899-PA 84..276 42..208 151 23.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:25:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21093-PA 308 GA21093-PA 1..308 1..309 1354 79 Plus
Dpse\GA24226-PA 353 GA24226-PA 55..352 41..308 205 26.9 Plus
Dpse\wg-PA 468 GA18504-PA 84..276 42..208 151 23.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:25:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25950-PA 309 GM25950-PA 1..309 1..309 1633 97.7 Plus
Dsec\GM21127-PA 352 GM21127-PA 55..351 41..308 207 27.5 Plus
Dsec\GM22805-PA 303 GM22805-PA 161..302 162..308 159 29.1 Plus
Dsec\GM13583-PA 539 GM13583-PA 270..538 47..308 153 23.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:25:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20509-PA 309 GD20509-PA 1..309 1..309 1644 98.4 Plus
Dsim\GD22501-PA 539 GD22501-PA 270..538 47..308 163 23.6 Plus
Dsim\GD15629-PA 969 GD15629-PA 827..968 162..308 161 29.1 Plus
Dsim\GD10659-PA 324 GD10659-PA 55..323 41..308 151 26 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:25:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10750-PA 311 GJ10750-PA 21..311 19..309 1196 74 Plus
Dvir\GJ15051-PA 343 GJ15051-PA 55..342 41..308 210 27.6 Plus
Dvir\GJ17616-PA 548 GJ17616-PA 281..547 47..308 161 22.7 Plus
Dvir\GJ21907-PA 414 GJ21907-PA 255..413 145..308 157 26.2 Plus
Dvir\wg-PA 472 GJ20848-PA 83..275 42..208 150 23.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13358-PA 309 GK13358-PA 1..309 2..309 1270 75.5 Plus
Dwil\GK15749-PA 356 GK15749-PA 55..355 41..308 160 24.7 Plus
Dwil\GK24728-PA 547 GK24728-PA 282..546 51..308 159 23.9 Plus
Dwil\GK21945-PA 997 GK21945-PA 838..996 145..308 156 25.6 Plus
Dwil\wg-PA 477 GK24298-PA 84..286 42..219 149 23.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24455-PA 309 GE24455-PA 1..309 1..309 1628 97.4 Plus
Dyak\GE19281-PA 352 GE19281-PA 55..351 41..308 206 27.5 Plus
Dyak\GE15518-PA 1003 GE15518-PA 861..1002 162..308 165 29.8 Plus
Dyak\GE18366-PA 550 GE18366-PA 281..549 47..308 163 23.6 Plus

RE57705.hyp Sequence

Translation from 60 to 989

> RE57705.hyp
MIFAITFFMGITSTLAAVLEPMSYYQYTQFQAPLSWEDITGKGLKQALDS
CQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTK
DCANGVIAGCGCTENALNVPCAHEPTKALEQYEKHFGSGSGAIGHNRRVV
GALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDA
IQLEGASSNLKIMWQNIPLDSLVFMQDSPNYCERDATGLWKGTRGRQCSK
DGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCV
QLERQYSCY*

RE57705.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
wntD-PA 309 CG8458-PA 1..309 1..309 1673 100 Plus
Wnt2-PB 325 CG1916-PB 28..324 41..308 273 27.3 Plus
Wnt2-PA 352 CG1916-PA 55..351 41..308 273 27.3 Plus
Wnt4-PB 539 CG4698-PB 270..538 47..308 190 24.6 Plus
Wnt4-PA 539 CG4698-PA 270..538 47..308 190 24.6 Plus