Clone RE57810 Report

Search the DGRC for RE57810

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:578
Well:10
Vector:pFlc-1
Associated Gene/TranscriptCG12975-RA
Protein status:RE57810.pep: gold
Preliminary Size:375
Sequenced Size:627

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12975 2001-12-14 Blastp of sequenced clone
CG12975 2002-01-01 Sim4 clustering to Release 2
CG12975 2003-01-01 Sim4 clustering to Release 3
CG12975 2008-04-29 Release 5.5 accounting
CG12975 2008-08-15 Release 5.9 accounting
CG12975 2008-12-18 5.12 accounting

Clone Sequence Records

RE57810.complete Sequence

627 bp (627 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071539

> RE57810.complete
AAGAAGAAGAAGAAGGAATACAACGTGCACCGCAACTATTATTTAAAAAC
ATTGTTGTTTACCTCATCTCTTTGTATTAATTAAACCATTACAAGCCCGA
AAATGAAACTCAGCACATACAACTTCTTGACCTCCGTGGCCATCAAGGGC
GTCAAAGTGGGATTTCCCCTGAAACTGACGATTAACAAAAAGGAAGTGGT
GGAGAGCGAATTTAATCCAACTTTTGTGGAGAGAATCCTTCCCAAGCTGG
ACTGGTCAGCGGTCTATGGAGCTGCTCAGGTGGCGGAACTCACAGAAGAC
ATTCCTGCCGTTCAGCCTGAAAACATTGTGGAGAATGAACTGCTTTTGCA
GAAGCTTCACCATCTGCTCTTCGAGATCGACGTGCTCGAGGGTCAACTGG
AGTGCCCGGAGACAGGTCGTGTGTTTCCCATCAGCGATGGTATACCAAAC
ATGCTCCTTAACGAGGACGAGGTCTAGATTACACCCATGTGCTTTTTGTA
CCATAATCCCCATAATCCCCTTTCTCCAGACGCGCATTAATATTAAATAA
GTTTGTTAGTTTTAAAGTTTGTTTATTTACGAGTTACTAAAAACAATTGG
AGCTTGGATAGAAAAAAAAAAAAAAAA

RE57810.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG12975-RA 620 CG12975-RA 10..619 4..613 3035 99.8 Plus
CG10508-RC 1695 CG10508-RC 1634..1695 613..552 295 98.3 Minus
CG10508.b 2112 CG10508.b 2051..2112 613..552 295 98.3 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21205002..21205329 609..282 1640 100 Minus
chr3L 24539361 chr3L 21205649..21205825 180..4 885 100 Minus
chr3L 24539361 chr3L 21205481..21205584 283..180 520 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:05:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21215993..21216324 613..282 1645 99.7 Minus
3L 28110227 3L 21216644..21216820 180..4 885 100 Minus
3L 28110227 3L 21216476..21216579 283..180 520 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21209093..21209424 613..282 1645 99.6 Minus
3L 28103327 3L 21209744..21209920 180..4 885 100 Minus
3L 28103327 3L 21209576..21209679 283..180 520 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:42:44 has no hits.

RE57810.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:43:45 Download gff for RE57810.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21205000..21205328 283..611 99 <- Minus
chr3L 21205482..21205583 181..282 100 <- Minus
chr3L 21205649..21205829 1..180 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:25:56 Download gff for RE57810.complete
Subject Subject Range Query Range Percent Splice Strand
CG12975-RA 1..375 103..477 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:15 Download gff for RE57810.complete
Subject Subject Range Query Range Percent Splice Strand
CG12975-RA 1..375 103..477 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:43:38 Download gff for RE57810.complete
Subject Subject Range Query Range Percent Splice Strand
CG12975-RA 1..375 103..477 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:37:23 Download gff for RE57810.complete
Subject Subject Range Query Range Percent Splice Strand
CG12975-RA 1..375 103..477 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:31:33 Download gff for RE57810.complete
Subject Subject Range Query Range Percent Splice Strand
CG12975-RA 1..375 103..477 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:25 Download gff for RE57810.complete
Subject Subject Range Query Range Percent Splice Strand
CG12975-RA 1..611 1..611 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:15 Download gff for RE57810.complete
Subject Subject Range Query Range Percent Splice Strand
CG12975-RA 1..611 1..611 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:43:38 Download gff for RE57810.complete
Subject Subject Range Query Range Percent Splice Strand
CG12975-RA 16..626 1..611 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:37:23 Download gff for RE57810.complete
Subject Subject Range Query Range Percent Splice Strand
CG12975-RA 1..611 1..611 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:31:33 Download gff for RE57810.complete
Subject Subject Range Query Range Percent Splice Strand
CG12975-RA 16..626 1..611 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:43:45 Download gff for RE57810.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21215995..21216323 283..611 99 <- Minus
3L 21216477..21216578 181..282 100 <- Minus
3L 21216644..21216824 1..180 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:43:45 Download gff for RE57810.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21215995..21216323 283..611 99 <- Minus
3L 21216477..21216578 181..282 100 <- Minus
3L 21216644..21216824 1..180 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:43:45 Download gff for RE57810.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21215995..21216323 283..611 99 <- Minus
3L 21216477..21216578 181..282 100 <- Minus
3L 21216644..21216824 1..180 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:43:38 Download gff for RE57810.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21209095..21209423 283..611 99 <- Minus
arm_3L 21209577..21209678 181..282 100 <- Minus
arm_3L 21209744..21209924 1..180 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:15:02 Download gff for RE57810.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21209095..21209423 283..611 99 <- Minus
3L 21209577..21209678 181..282 100 <- Minus
3L 21209744..21209924 1..180 99   Minus

RE57810.pep Sequence

Translation from 102 to 476

> RE57810.pep
MKLSTYNFLTSVAIKGVKVGFPLKLTINKKEVVESEFNPTFVERILPKLD
WSAVYGAAQVAELTEDIPAVQPENIVENELLLQKLHHLLFEIDVLEGQLE
CPETGRVFPISDGIPNMLLNEDEV*

RE57810.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10180-PA 124 GF10180-PA 1..124 1..124 531 89.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13253-PA 124 GG13253-PA 1..124 1..124 556 95.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16524-PA 124 GH16524-PA 1..124 1..124 530 86.3 Plus
Dgri\GH12113-PA 124 GH12113-PA 1..124 1..124 530 86.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG12975-PA 124 CG12975-PA 1..124 1..124 631 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12204-PA 124 GI12204-PA 1..124 1..124 528 85.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24597-PA 124 GL24597-PA 1..124 1..124 546 91.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11949-PA 124 GA11949-PA 1..124 1..124 546 91.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22158-PA 124 GM22158-PA 1..124 1..124 558 96 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12134-PA 124 GD12134-PA 1..124 1..124 621 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11437-PA 124 GJ11437-PA 1..124 1..124 539 87.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17370-PA 124 GK17370-PA 1..124 1..124 547 91.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22955-PA 124 GE22955-PA 1..124 1..124 616 95.2 Plus
Dyak\GE22352-PA 121 GE22352-PA 24..121 27..124 490 94.9 Plus

RE57810.hyp Sequence

Translation from 102 to 476

> RE57810.hyp
MKLSTYNFLTSVAIKGVKVGFPLKLTINKKEVVESEFNPTFVERILPKLD
WSAVYGAAQVAELTEDIPAVQPENIVENELLLQKLHHLLFEIDVLEGQLE
CPETGRVFPISDGIPNMLLNEDEV*

RE57810.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG12975-PA 124 CG12975-PA 1..124 1..124 631 100 Plus