Clone RE57845 Report

Search the DGRC for RE57845

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:578
Well:45
Vector:pFlc-1
Associated Gene/Transcriptlbm-RA
Protein status:RE57845.pep: gold
Preliminary Size:1006
Sequenced Size:1040

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2374 2001-12-14 Blastp of sequenced clone
CG2374 2002-01-01 Sim4 clustering to Release 2
CG2374 2003-01-01 Sim4 clustering to Release 3
lbm 2008-04-29 Release 5.5 accounting
lbm 2008-08-15 Release 5.9 accounting
lbm 2008-12-18 5.12 accounting

Clone Sequence Records

RE57845.complete Sequence

1040 bp (1040 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071541

> RE57845.complete
GAGTTCGCCAGCGAACGCAGAACGCGCCAGACCAAAAAGTTCAGATTCGA
GAGCGGATATCCCGGCGAGCGTTCAGCGGAAATATATTTGTTTGTTATTC
GAGTCCAGCAACGAATATTTAAATAAACAAAAAACGAACTTTATTCGTGT
GCGGAGAGAGAAGTCAAAAGATCCAATAAAATGGGTTGCGCCACGACCAG
CGTGAAGATCGCCTCCATCGTTCTGAATGCCGTTTTAGGGTTTCTTGCTG
CTGGGGCCATCGGCTGGATAGCTTACAATGCGGACACGGAGACGGAGGAA
TTCGTAATAGCCGCTTACATCGCGTGCTCGCTCATCCTGGTCTTTGCTCT
GCTGGGCATCTTCGCGGCCATCCGGGAATCGGTGGTGCTGACTGCAACGA
GTGCTGTCTTCCTGCTGATCTTGGCCATCCTGCAGATCGTGAGCACCTGC
CTGTTCCTCCACGAGTTCGACGTGAAGAGCGGCCGGGACATGGTGGAGGT
GGCCTGGCAGGCGAACAACATGGATTCCTTGCAGCAGAAGCACGAGTGCT
GCGGCCAGAGCAGCGCCCAGGACTATATCCACCTCAGCCTGCTGATCCCG
CCCAGCTGCTACGCGGATCTGCAGCAGACCCCCGACCACCTCTATCTGGA
CGGGTGCATCGAAAAGGTGCAGAGCTTCTACGAAAGCGACAAGCTGCGCT
TCATCATAGTGTCCTGGGTGCTAGTGGCCTTCGAGTTAATCTGCTTCGCC
TTGGCCGTGTTTCTGGCCATTAGTTTTAAGAACAAGCAGCGACGGATGGA
GTTCTAGTTCTAGGCCTTCGGTAATCTCGAGCTATCCAACAGTACAAACT
CGGAATCGGGGTCTCGCTGATATTTTTCTCTTCAACATTTCATAACCAAA
TGCAAAGGACAGTCATAAATTATTCACTCCTACCTTAATGTAACCTGTAA
TTAAAGTACATATTTATAGTTCAATTACCCATTATAAGTATCATAATAAA
TGTGCGCGTGTTTGTTTTCACACGAAAAAAAAAAAAAAAA

RE57845.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
lbm.c 1330 lbm.c 28..1048 2..1022 5105 100 Plus
lbm-RA 1096 lbm-RA 28..1048 2..1022 5105 100 Plus
lbm.b 1550 lbm.b 28..1048 2..1022 5105 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:44:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2938682..2939018 399..735 1685 100 Plus
chr2R 21145070 chr2R 2939079..2939367 734..1022 1445 100 Plus
chr2R 21145070 chr2R 2937201..2937369 2..170 845 100 Plus
chr2R 21145070 chr2R 2938467..2938626 240..399 800 100 Plus
chr2R 21145070 chr2R 2937436..2937507 169..240 345 98.6 Plus
chr2R 21145070 chr2R 2927551..2927602 2..53 245 98.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:05:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7051277..7051613 399..735 1685 100 Plus
2R 25286936 2R 7051674..7051962 734..1022 1445 100 Plus
2R 25286936 2R 7049797..7049965 2..170 845 100 Plus
2R 25286936 2R 7051062..7051221 240..399 800 100 Plus
2R 25286936 2R 7050032..7050103 169..240 360 100 Plus
2R 25286936 2R 7040139..7040190 2..53 245 98.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7052476..7052812 399..735 1685 100 Plus
2R 25260384 2R 7052873..7053161 734..1022 1445 100 Plus
2R 25260384 2R 7050996..7051164 2..170 845 100 Plus
2R 25260384 2R 7052261..7052420 240..399 800 100 Plus
2R 25260384 2R 7051231..7051302 169..240 360 100 Plus
2R 25260384 2R 7041338..7041389 2..53 245 98 Plus
Blast to na_te.dros performed on 2019-03-16 08:44:00 has no hits.

RE57845.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:45:12 Download gff for RE57845.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2939081..2939369 736..1024 99   Plus
chr2R 2937200..2937369 1..170 99 -> Plus
chr2R 2937438..2937507 171..240 98 -> Plus
chr2R 2938468..2938626 241..399 100 -> Plus
chr2R 2938683..2939018 400..735 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:25:58 Download gff for RE57845.complete
Subject Subject Range Query Range Percent Splice Strand
lbm-RA 1..627 181..807 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:05 Download gff for RE57845.complete
Subject Subject Range Query Range Percent Splice Strand
lbm-RA 1..627 181..807 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:56:34 Download gff for RE57845.complete
Subject Subject Range Query Range Percent Splice Strand
lbm-RA 1..627 181..807 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:37:13 Download gff for RE57845.complete
Subject Subject Range Query Range Percent Splice Strand
lbm-RA 1..627 181..807 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:48:05 Download gff for RE57845.complete
Subject Subject Range Query Range Percent Splice Strand
lbm-RA 1..627 181..807 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:11 Download gff for RE57845.complete
Subject Subject Range Query Range Percent Splice Strand
lbm-RA 2..1024 2..1024 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:05 Download gff for RE57845.complete
Subject Subject Range Query Range Percent Splice Strand
lbm-RA 2..1024 2..1024 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:56:34 Download gff for RE57845.complete
Subject Subject Range Query Range Percent Splice Strand
lbm-RA 6..1029 1..1024 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:37:13 Download gff for RE57845.complete
Subject Subject Range Query Range Percent Splice Strand
lbm-RA 2..1024 2..1024 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:48:05 Download gff for RE57845.complete
Subject Subject Range Query Range Percent Splice Strand
lbm-RA 6..1029 1..1024 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:45:12 Download gff for RE57845.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7049796..7049965 1..170 99 -> Plus
2R 7050034..7050103 171..240 100 -> Plus
2R 7051063..7051221 241..399 100 -> Plus
2R 7051278..7051613 400..735 100 -> Plus
2R 7051676..7051964 736..1024 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:45:12 Download gff for RE57845.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7049796..7049965 1..170 99 -> Plus
2R 7050034..7050103 171..240 100 -> Plus
2R 7051063..7051221 241..399 100 -> Plus
2R 7051278..7051613 400..735 100 -> Plus
2R 7051676..7051964 736..1024 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:45:12 Download gff for RE57845.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7049796..7049965 1..170 99 -> Plus
2R 7050034..7050103 171..240 100 -> Plus
2R 7051063..7051221 241..399 100 -> Plus
2R 7051278..7051613 400..735 100 -> Plus
2R 7051676..7051964 736..1024 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:56:34 Download gff for RE57845.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2937301..2937470 1..170 99 -> Plus
arm_2R 2937539..2937608 171..240 100 -> Plus
arm_2R 2938568..2938726 241..399 100 -> Plus
arm_2R 2938783..2939118 400..735 100 -> Plus
arm_2R 2939181..2939469 736..1024 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:50 Download gff for RE57845.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7052477..7052812 400..735 100 -> Plus
2R 7052875..7053163 736..1024 99   Plus
2R 7050995..7051164 1..170 99 -> Plus
2R 7051233..7051302 171..240 100 -> Plus
2R 7052262..7052420 241..399 100 -> Plus

RE57845.pep Sequence

Translation from 180 to 806

> RE57845.pep
MGCATTSVKIASIVLNAVLGFLAAGAIGWIAYNADTETEEFVIAAYIACS
LILVFALLGIFAAIRESVVLTATSAVFLLILAILQIVSTCLFLHEFDVKS
GRDMVEVAWQANNMDSLQQKHECCGQSSAQDYIHLSLLIPPSCYADLQQT
PDHLYLDGCIEKVQSFYESDKLRFIIVSWVLVAFELICFALAVFLAISFK
NKQRRMEF*

RE57845.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:21:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12690-PA 208 GF12690-PA 1..208 1..208 935 82.2 Plus
Dana\GF12691-PA 218 GF12691-PA 1..218 1..208 220 30 Plus
Dana\GF12689-PA 217 GF12689-PA 1..217 1..208 212 28.6 Plus
Dana\GF12682-PA 227 GF12682-PA 1..227 1..208 212 32 Plus
Dana\GF13154-PA 226 GF13154-PA 48..226 37..208 193 30.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:21:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23252-PA 208 GG23252-PA 1..208 1..208 1004 92.3 Plus
Dere\GG23251-PA 217 GG23251-PA 1..217 1..208 241 31.4 Plus
Dere\GG23255-PA 211 GG23255-PA 1..208 1..205 207 27.7 Plus
Dere\GG23253-PA 218 GG23253-PA 1..218 1..208 204 29.1 Plus
Dere\GG10774-PA 219 GG10774-PA 1..215 1..205 189 29.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:21:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21508-PA 211 GH21508-PA 1..211 1..208 842 74.4 Plus
Dgri\GH21512-PA 218 GH21512-PA 1..218 1..208 248 30.3 Plus
Dgri\GH21509-PA 218 GH21509-PA 1..218 1..208 235 31.5 Plus
Dgri\GH21507-PA 217 GH21507-PA 1..217 1..208 201 29.9 Plus
Dgri\GH21500-PA 219 GH21500-PA 3..219 4..208 189 28.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:59
Subject Length Description Subject Range Query Range Score Percent Strand
lbm-PB 208 CG2374-PB 1..208 1..208 1053 100 Plus
lbm-PA 208 CG2374-PA 1..208 1..208 1053 100 Plus
Tsp42El-PA 217 CG12840-PA 1..217 1..208 257 32 Plus
Tsp42En-PB 218 CG12839-PB 1..218 1..208 243 31.7 Plus
Tsp42En-PA 218 CG12839-PA 1..218 1..208 243 31.7 Plus
Tsp42Er-PA 211 CG12837-PA 1..211 1..208 235 29.2 Plus
Tsp42Ee-PB 228 CG10106-PB 1..225 1..205 223 34.1 Plus
Tsp42Ee-PA 228 CG10106-PA 1..225 1..205 223 34.1 Plus
Tsp42Eq-PA 219 CG12832-PA 1..215 1..205 198 27.8 Plus
Tsp42Eh-PB 231 CG12844-PB 1..229 1..208 188 25.3 Plus
Tsp42Eg-PA 218 CG12142-PA 1..215 1..208 184 29.6 Plus
Tsp42Ef-PA 220 CG12845-PA 3..220 4..208 182 27.9 Plus
Tsp42Ea-PC 226 CG18817-PC 49..226 38..208 176 28.5 Plus
Tsp42Ea-PB 226 CG18817-PB 49..226 38..208 176 28.5 Plus
Tsp42Ea-PA 226 CG18817-PA 49..226 38..208 176 28.5 Plus
Tsp42Ek-PB 215 CG12841-PB 1..215 1..208 171 24.5 Plus
Tsp42Ek-PA 215 CG12841-PA 1..215 1..208 171 24.5 Plus
Tsp42Ep-PB 250 CG4471-PB 3..219 2..205 161 23.4 Plus
Tsp42Ep-PA 250 CG4471-PA 3..219 2..205 161 23.4 Plus
Tsp42Ei-PB 229 CG12843-PB 1..223 1..205 156 28.1 Plus
Tsp42Ei-PA 229 CG12843-PA 1..223 1..205 156 28.1 Plus
Tsp42Ec-PA 232 CG12847-PA 27..214 8..192 149 25.6 Plus
CG30160-PA 222 CG30160-PA 18..222 8..202 144 26.3 Plus
Tsp42Eb-PB 222 CG18816-PB 18..222 8..202 144 26.3 Plus
Tsp47F-PB 239 CG9033-PB 4..239 3..205 143 25.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:21:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19477-PA 208 GI19477-PA 1..208 1..208 876 76.9 Plus
Dmoj\GI19481-PA 220 GI19481-PA 1..220 1..208 244 30 Plus
Dmoj\GI19479-PA 218 GI19479-PA 55..218 50..208 217 33.5 Plus
Dmoj\GI19476-PA 217 GI19476-PA 1..217 1..208 211 30.8 Plus
Dmoj\GI19464-PA 226 GI19464-PA 48..226 37..208 191 30.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11147-PA 208 GL11147-PA 1..208 1..208 945 82.7 Plus
Dper\GL11146-PA 217 GL11146-PA 1..217 1..208 242 30.8 Plus
Dper\GL11150-PA 210 GL11150-PA 10..204 15..205 211 28.4 Plus
Dper\GL11148-PA 218 GL11148-PA 1..218 1..208 204 29.7 Plus
Dper\GL11133-PA 226 GL11133-PA 48..226 37..208 198 30.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:21:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24625-PA 208 GA24625-PA 1..208 1..208 945 82.7 Plus
Dpse\GA11846-PA 217 GA11846-PA 1..217 1..208 246 31.2 Plus
Dpse\GA11845-PA 218 GA11845-PA 1..218 1..208 204 29.7 Plus
Dpse\GA15095-PA 226 GA15095-PA 48..226 37..208 198 30.4 Plus
Dpse\GA10076-PA 228 GA10076-PA 24..228 14..208 197 31.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:21:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20925-PA 208 GM20925-PA 1..208 1..208 1064 97.6 Plus
Dsec\GM20924-PA 217 GM20924-PA 1..217 1..208 245 31.5 Plus
Dsec\GM20926-PA 218 GM20926-PA 1..218 1..208 202 29.7 Plus
Dsec\GM20823-PA 219 GM20823-PA 1..215 1..205 191 28.6 Plus
Dsec\GM20918-PA 231 GM20918-PA 1..229 1..208 189 28.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:21:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15337-PA 188 GD15337-PA 2..188 22..208 954 97.3 Plus
Dsim\GD10455-PA 211 GD10455-PA 1..208 1..205 232 30 Plus
Dsim\GD10452-PA 217 GD10452-PA 1..217 1..208 218 32.4 Plus
Dsim\GD10276-PA 219 GD10276-PA 1..215 1..205 193 28.6 Plus
Dsim\GD10445-PA 225 GD10445-PA 3..225 4..208 178 27.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:21:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15138-PA 208 GJ15138-PA 1..208 1..208 878 76.4 Plus
Dvir\GJ15141-PA 220 GJ15141-PA 1..220 1..208 233 32.1 Plus
Dvir\GJ15137-PA 217 GJ15137-PA 1..217 1..208 214 31.7 Plus
Dvir\GJ15139-PA 218 GJ15139-PA 1..218 1..208 207 29.1 Plus
Dvir\GJ14948-PA 219 GJ14948-PA 1..215 1..205 204 31.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:21:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21784-PA 208 GK21784-PA 1..208 1..208 888 78.8 Plus
Dwil\GK21783-PA 217 GK21783-PA 1..217 1..208 278 32 Plus
Dwil\GK21787-PA 215 GK21787-PA 1..215 1..208 232 30.9 Plus
Dwil\GK21785-PA 218 GK21785-PA 55..218 50..208 205 31.7 Plus
Dwil\GK21531-PA 219 GK21531-PA 1..215 1..205 190 28.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:21:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19102-PA 208 GE19102-PA 1..208 1..208 1062 97.1 Plus
Dyak\GE19105-PA 211 GE19105-PA 1..208 1..205 229 29.6 Plus
Dyak\GE24235-PA 219 GE24235-PA 1..215 1..205 211 30 Plus
Dyak\GE19101-PA 217 GE19101-PA 1..217 1..208 206 31 Plus
Dyak\GE19103-PA 218 GE19103-PA 1..218 1..208 200 30 Plus

RE57845.hyp Sequence

Translation from 180 to 806

> RE57845.hyp
MGCATTSVKIASIVLNAVLGFLAAGAIGWIAYNADTETEEFVIAAYIACS
LILVFALLGIFAAIRESVVLTATSAVFLLILAILQIVSTCLFLHEFDVKS
GRDMVEVAWQANNMDSLQQKHECCGQSSAQDYIHLSLLIPPSCYADLQQT
PDHLYLDGCIEKVQSFYESDKLRFIIVSWVLVAFELICFALAVFLAISFK
NKQRRMEF*

RE57845.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
lbm-PB 208 CG2374-PB 1..208 1..208 1053 100 Plus
lbm-PA 208 CG2374-PA 1..208 1..208 1053 100 Plus
Tsp42El-PA 217 CG12840-PA 1..217 1..208 257 32 Plus
Tsp42En-PB 218 CG12839-PB 1..218 1..208 243 31.7 Plus
Tsp42En-PA 218 CG12839-PA 1..218 1..208 243 31.7 Plus