Clone RE57896 Report

Search the DGRC for RE57896

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:578
Well:96
Vector:pFlc-1
Associated Gene/Transcriptbcn92-RA
Protein status:RE57896.pep: gold
Preliminary Size:279
Sequenced Size:705

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3717 2002-01-01 Sim4 clustering to Release 2
CG3717 2003-01-01 Sim4 clustering to Release 3
bcn92 2008-04-29 Release 5.5 accounting
bcn92 2008-08-15 Release 5.9 accounting
bcn92 2008-12-18 5.12 accounting

Clone Sequence Records

RE57896.complete Sequence

705 bp (705 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071542

> RE57896.complete
AAAAACAAGAAACCAGGGTCAAAACAAAGCACTCATCAATTAAACAGCAC
TTTAATCCACCAGCCCGCCCGCCATTCAGTTCCATTCGGCCAGGATCAAG
ACCAGGATGTCGACCCGTCGCCAGGCGATCACGTTATACAGGAATCTCCT
GCGCGAATCGGAGAAGCTGCCCTCGTACAACTTCAGAATGTACGCTGCCC
GAAAAATACGCGACACATTCCGCGCCAACAGGAGCACCAGGGACTTCGCG
GAGATCGATCGCCAAATGGCCGAGGGCCAACAGAATCTGGAGCTGATACG
TCGCCAGGTAATCATCGGCCACCTGTATTCCGCTGACAAACTGGTTATAG
AGAACAAGAAGACCCTGAAGCCCTCGGACGACTAAGGGAAATACGGAGCG
AAAAACGCGCTAGCTGAAGAGAGTACAATAGCAGGGAAGGAGCGGTAGAA
GGAGCAGGAGGCGTCTCCAGATGAAGACACAACTCGAAAGACTCGACCCA
CACACAACACAACACACCAAACCACACGCATTGTTGATTTTAAATGGCAC
TTGCATTCATGAAACTAAGGAATCAAAATCATTTGCTAGCAAAAAAAACA
CCAATTTAATGTTATGTTTAACAACAATTATGAAATTCTATATACATACA
TATATATTAATGGTATAAATAAGTACTAAAGTACTCCAGAAAAAAAAAAA
AAAAA

RE57896.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:38
Subject Length Description Subject Range Query Range Score Percent Strand
bcn92-RA 857 bcn92-RA 156..853 3..701 3440 99.7 Plus
Pgd.a 1461 Pgd.a 1346..1455 701..592 535 99 Minus
Pgd-RA 1932 Pgd-RA 1817..1926 701..592 535 99 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2042392..2042775 689..305 1875 99.7 Minus
chrX 22417052 chrX 2043331..2043514 186..3 920 100 Minus
chrX 22417052 chrX 2043148..2043275 309..182 640 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:05:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2148451..2148846 701..305 1920 99.5 Minus
X 23542271 X 2149402..2149585 186..3 920 100 Minus
X 23542271 X 2149219..2149346 309..182 640 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2156549..2156944 701..305 1930 99.4 Minus
X 23527363 X 2157500..2157683 186..3 920 100 Minus
X 23527363 X 2157317..2157444 309..182 640 100 Minus
Blast to na_te.dros performed 2019-03-16 20:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 3912..4024 567..684 154 63.9 Plus

RE57896.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:21:56 Download gff for RE57896.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2042392..2042772 308..689 99 <- Minus
chrX 2043150..2043270 187..307 100 <- Minus
chrX 2043331..2043514 1..186 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:26:00 Download gff for RE57896.complete
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 1..279 107..385 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:12:44 Download gff for RE57896.complete
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 1..279 107..385 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:53:54 Download gff for RE57896.complete
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 1..279 107..385 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:36:54 Download gff for RE57896.complete
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 1..279 107..385 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:59:52 Download gff for RE57896.complete
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 1..279 107..385 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:43:31 Download gff for RE57896.complete
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 14..701 1..689 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:12:44 Download gff for RE57896.complete
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 14..701 1..689 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:53:54 Download gff for RE57896.complete
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 61..748 1..689 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:36:54 Download gff for RE57896.complete
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 14..701 1..689 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:59:52 Download gff for RE57896.complete
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 61..748 1..689 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:21:56 Download gff for RE57896.complete
Subject Subject Range Query Range Percent Splice Strand
X 2148463..2148843 308..689 99 <- Minus
X 2149221..2149341 187..307 100 <- Minus
X 2149402..2149585 1..186 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:21:56 Download gff for RE57896.complete
Subject Subject Range Query Range Percent Splice Strand
X 2148463..2148843 308..689 99 <- Minus
X 2149221..2149341 187..307 100 <- Minus
X 2149402..2149585 1..186 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:21:56 Download gff for RE57896.complete
Subject Subject Range Query Range Percent Splice Strand
X 2148463..2148843 308..689 99 <- Minus
X 2149221..2149341 187..307 100 <- Minus
X 2149402..2149585 1..186 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:53:54 Download gff for RE57896.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2042496..2042876 308..689 99 <- Minus
arm_X 2043254..2043374 187..307 100 <- Minus
arm_X 2043435..2043618 1..186 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:27 Download gff for RE57896.complete
Subject Subject Range Query Range Percent Splice Strand
X 2156561..2156941 308..689 99 <- Minus
X 2157319..2157439 187..307 100 <- Minus
X 2157500..2157683 1..186 98   Minus

RE57896.hyp Sequence

Translation from 3 to 335

> RE57896.hyp
NKKPGSKQSTHQLNSTLIHQPARHSVPFGQDQDQDVDPSPGDHVIQESPA
RIGEAALVQLQNVRCPKNTRHIPRQQEHQGLRGDRSPNGRGPTESGADTS
PGNHRPPVFR*
Sequence RE57896.hyp has no blast hits.

RE57896.pep Sequence

Translation from 106 to 384

> RE57896.pep
MSTRRQAITLYRNLLRESEKLPSYNFRMYAARKIRDTFRANRSTRDFAEI
DRQMAEGQQNLELIRRQVIIGHLYSADKLVIENKKTLKPSDD*

RE57896.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20805-PA 92 GF20805-PA 1..92 1..92 435 89.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12648-PA 92 GG12648-PA 1..92 1..92 473 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24400-PA 92 GH24400-PA 1..92 1..92 417 85.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
bcn92-PA 92 CG3717-PA 1..92 1..92 460 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11059-PA 92 GI11059-PA 1..92 1..92 400 82.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14467-PA 92 GL14467-PA 1..92 1..92 415 84.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17638-PA 92 GA17638-PA 1..92 1..92 422 85.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18915-PA 92 GM18915-PA 1..92 1..92 473 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16390-PA 92 GD16390-PA 1..92 1..92 473 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16510-PA 92 GJ16510-PA 1..92 1..92 402 83.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24926-PA 92 GK24926-PA 1..92 1..92 407 83.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16975-PA 92 GE16975-PA 1..92 1..92 466 97.8 Plus