Clone RE58349 Report

Search the DGRC for RE58349

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:583
Well:49
Vector:pFlc-1
Associated Gene/TranscriptCG4666-RA
Protein status:RE58349.pep: gold
Preliminary Size:729
Sequenced Size:1076

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4666 2001-12-14 Blastp of sequenced clone
CG4666 2002-01-01 Sim4 clustering to Release 2
CG4666 2003-01-01 Sim4 clustering to Release 3
CG4666 2008-04-29 Release 5.5 accounting
CG4666 2008-08-15 Release 5.9 accounting
CG4666 2008-12-18 5.12 accounting

Clone Sequence Records

RE58349.complete Sequence

1076 bp (1076 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071547

> RE58349.complete
GAGGCGACGTTGGCCTTGCTTACCCAACGGTTGTGTTGCTGCGTACCGCT
CCGCCCGCTTTTACCGCACCGTACCGTCCCTCCCCGCTCTTACCGATCGA
ACCCAGTTGGTGGTGTGTTTGGCCGAGCTTAACGACCGACTGCAAATTGG
GAATCCAGACACACACAACCAGATATCGCGATGTCTTGGCTGGTTGTTTT
GTTGATCCTGTACGTAATCTGGGATGTCAACTACTTCATCCGCTGCGTGT
TCACGGTGTTCGCCGGCCGGCTGTTCCAGCGGAAGCGCAAGGTCACGGAC
ACCACGACGATCTATGGACTGTGCACCTCGCAGGACGTGGACATCTTTAT
CCGGCACATGAACAACGCCCGCTATCTGCGCGAACTGGACTTTGCCCGCT
TCCATTTCTACGCCCTCACTGGACTCTATGAGCGCATCCGGGACCGACGC
GGCGGTGCCGTCCAGGGAGCCAGCAGTGTTCGCTACCGCCGCACCATACC
CATCTTCCATCCGTACAAGATTCAGACCAAGCTGATCTGGTGGGACGACA
AGGCCATTTACCTGGAGCAGCAGTTTATTACCCTTTCGGACGGATTTGTA
CGCGCGGTGGCCATGTCCAAGCAGAACATCACCAACTGCAATGTGCTGGA
GGTACTGAAGACCTATCCGGAAACTGCCCAGCGACCGGAGAAGCCGGAGG
AGCTCAAGCTCTGGCTGGATGCCATCGAGCTGTCCAGCCAGAAGCTGCGA
AAGGACAAGTGAATCGATTGATTGATTCCATCTCCCGCAGCACAGCTCAT
TTACATATGTTTGCCTCATTTACTTAGATTCGTAGTCATCTTCTATTTTT
TTTTTTTGAGTGCATAGTGAAGTAATTCTAGACTGGTGGGTTTTTCACAC
AAAAAAGAGCGTAACAAAATGTACACAAGTCATGAATCTAAACAATGGCC
CATAGCAACTTAAAGACTTTATTTGCTATTATTTTTTCACTGTGCCTTAG
TTATAGGAATATTGCATTAATGGAATGGCTGAAGATTTTAAATATAATTT
TTTACAAACCAAAAAAAAAAAAAAAA

RE58349.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG4666-RA 1370 CG4666-RA 252..1312 5..1065 5275 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:45:57
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 5968297..5969210 1060..148 4370 98.8 Minus
chrX 22417052 chrX 5969577..5969719 147..5 700 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:05:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6076067..6076984 1065..148 4575 99.9 Minus
X 23542271 X 6077337..6077479 147..5 700 99.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6084165..6085082 1065..148 4575 99.8 Minus
X 23527363 X 6085435..6085577 147..5 700 99.3 Minus
Blast to na_te.dros performed on 2019-03-16 14:45:55 has no hits.

RE58349.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:47:03 Download gff for RE58349.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 5968297..5969210 148..1060 98 <- Minus
chrX 5969577..5969722 1..147 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:26:20 Download gff for RE58349.complete
Subject Subject Range Query Range Percent Splice Strand
CG4666-RA 1..582 181..762 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:14:34 Download gff for RE58349.complete
Subject Subject Range Query Range Percent Splice Strand
CG4666-RA 1..582 181..762 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:50:22 Download gff for RE58349.complete
Subject Subject Range Query Range Percent Splice Strand
CG4666-RA 1..582 181..762 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:39:51 Download gff for RE58349.complete
Subject Subject Range Query Range Percent Splice Strand
CG4666-RA 1..582 181..762 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:32:06 Download gff for RE58349.complete
Subject Subject Range Query Range Percent Splice Strand
CG4666-RA 1..582 181..762 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:46:11 Download gff for RE58349.complete
Subject Subject Range Query Range Percent Splice Strand
CG4666-RA 1..1059 2..1060 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:14:33 Download gff for RE58349.complete
Subject Subject Range Query Range Percent Splice Strand
CG4666-RA 1..1059 2..1060 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:50:22 Download gff for RE58349.complete
Subject Subject Range Query Range Percent Splice Strand
CG4666-RA 48..1106 1..1059 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:39:51 Download gff for RE58349.complete
Subject Subject Range Query Range Percent Splice Strand
CG4666-RA 1..1059 2..1060 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:32:06 Download gff for RE58349.complete
Subject Subject Range Query Range Percent Splice Strand
CG4666-RA 48..1107 1..1060 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:03 Download gff for RE58349.complete
Subject Subject Range Query Range Percent Splice Strand
X 6077337..6077482 1..147 97   Minus
X 6076072..6076984 148..1060 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:03 Download gff for RE58349.complete
Subject Subject Range Query Range Percent Splice Strand
X 6077337..6077482 1..147 97   Minus
X 6076072..6076984 148..1060 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:03 Download gff for RE58349.complete
Subject Subject Range Query Range Percent Splice Strand
X 6077337..6077482 1..147 97   Minus
X 6076072..6076984 148..1060 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:50:22 Download gff for RE58349.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5970105..5971017 148..1060 99 <- Minus
arm_X 5971370..5971515 1..147 97   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:16:32 Download gff for RE58349.complete
Subject Subject Range Query Range Percent Splice Strand
X 6084170..6085082 148..1060 99 <- Minus
X 6085435..6085580 1..147 97   Minus

RE58349.pep Sequence

Translation from 180 to 761

> RE58349.pep
MSWLVVLLILYVIWDVNYFIRCVFTVFAGRLFQRKRKVTDTTTIYGLCTS
QDVDIFIRHMNNARYLRELDFARFHFYALTGLYERIRDRRGGAVQGASSV
RYRRTIPIFHPYKIQTKLIWWDDKAIYLEQQFITLSDGFVRAVAMSKQNI
TNCNVLEVLKTYPETAQRPEKPEELKLWLDAIELSSQKLRKDK*

RE58349.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20315-PA 193 GF20315-PA 1..193 1..193 946 90.2 Plus
Dana\GF20314-PA 236 GF20314-PA 9..154 1..167 308 35.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:25:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17699-PA 193 GG17699-PA 1..193 1..193 1021 99 Plus
Dere\GG17698-PA 261 GG17698-PA 9..176 1..167 363 38.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:25:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24111-PA 193 GH24111-PA 1..193 1..193 847 85.5 Plus
Dgri\GH24110-PA 283 GH24110-PA 9..179 1..169 359 38.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG4666-PB 193 CG4666-PB 1..193 1..193 1013 100 Plus
CG4666-PA 193 CG4666-PA 1..193 1..193 1013 100 Plus
CG4660-PA 261 CG4660-PA 9..167 1..159 356 39.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16370-PA 193 GI16370-PA 14..193 14..193 861 87.8 Plus
Dmoj\GI17389-PA 207 GI17389-PA 1..192 1..192 627 56.2 Plus
Dmoj\GI16369-PA 258 GI16369-PA 9..180 1..168 369 40.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14956-PA 134 GL14956-PA 1..134 60..193 654 89.6 Plus
Dper\GL14955-PA 268 GL14955-PA 9..183 1..174 377 39.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:26:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22284-PA 193 GA22284-PA 1..193 1..193 956 90.7 Plus
Dpse\GA18337-PA 268 GA18337-PA 9..183 1..174 377 39.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:26:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12597-PA 193 GM12597-PA 1..193 1..193 1025 99.5 Plus
Dsec\GM12596-PA 261 GM12596-PA 9..176 1..167 361 38.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:26:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16216-PA 193 GD16216-PA 1..193 1..193 1029 100 Plus
Dsim\GD16215-PA 261 GD16215-PA 9..176 1..167 361 38.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:26:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16742-PA 193 GJ16742-PA 14..193 14..193 842 85.6 Plus
Dvir\GJ18066-PA 203 GJ18066-PA 21..199 15..193 666 66.5 Plus
Dvir\GJ16741-PA 264 GJ16741-PA 25..178 17..169 337 39.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17434-PA 193 GK17434-PA 1..193 1..193 921 92.2 Plus
Dwil\GK17423-PA 263 GK17423-PA 9..191 1..181 369 38.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16486-PA 193 GE16486-PA 1..193 1..193 1012 97.4 Plus
Dyak\GE16485-PA 261 GE16485-PA 9..176 1..167 361 38.7 Plus

RE58349.hyp Sequence

Translation from 180 to 761

> RE58349.hyp
MSWLVVLLILYVIWDVNYFIRCVFTVFAGRLFQRKRKVTDTTTIYGLCTS
QDVDIFIRHMNNARYLRELDFARFHFYALTGLYERIRDRRGGAVQGASSV
RYRRTIPIFHPYKIQTKLIWWDDKAIYLEQQFITLSDGFVRAVAMSKQNI
TNCNVLEVLKTYPETAQRPEKPEELKLWLDAIELSSQKLRKDK*

RE58349.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:33:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG4666-PB 193 CG4666-PB 1..193 1..193 1013 100 Plus
CG4666-PA 193 CG4666-PA 1..193 1..193 1013 100 Plus
CG4660-PA 261 CG4660-PA 9..167 1..159 356 39.6 Plus