BDGP Sequence Production Resources |
Search the DGRC for RE58687
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 586 |
Well: | 87 |
Vector: | pFlc-1 |
Associated Gene/Transcript | P5cr-2-RA |
Protein status: | RE58687.pep: gold |
Sequenced Size: | 1000 |
Gene | Date | Evidence |
---|---|---|
CG5840 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5840 | 2003-08-11 | Blastp of sequenced clone |
CG5840 | 2008-04-29 | Release 5.5 accounting |
CG5840 | 2008-08-15 | Release 5.9 accounting |
CG5840 | 2008-12-18 | 5.12 accounting |
1000 bp (1000 high quality bases) assembled on 2003-08-11
GenBank Submission: BT010232
> RE58687.complete CAACGCCGGCGGCGGGCGCACAGTTGCCGTTCCACCAGCAGAAAGTTCAG TACTCACAGTCCGCGGACTTTTTAACCCATTAACTAATGTCGGCAATCGG AAAGATCGGATTCCTGGGAGGCGGGAATATGGCCAAGGCTTTGGCTAAGG GTTTCCTAGCGGCCGGCCTGGCCAAACCCAATACCCTGATAGCCAGCGTC CATCCGGCAGATAAGCTCTCCCTGCAGTCCTTTCAATCCCTGGGAGTGGA AACAGTGATCAAGAATGCACCCGTTGTGCAGCAATCGGATGTGGTCTTCG TGTCCGTGAAACCCCAAGTGGTTCCCTCGGTTTTGTCGGAGATTCAGCCA TTGAGCTCGGGCAAACTATTCCTTTCCGTGGCCATGGGCATCACGTTGTC CACCATCGAGTCCAGTTTATCTCCACAAGCTCGCGTCATCCGTGTGATGC CCAATCTGCCGGCTGTCGTGTGTTCCGGTTGTTCGGTTTTCGTTCGCGGA TCCAAGGCCACAGATGCAGATGCGGATATTACCCAGAAGCTGCTGCAGTC CGTGGGCACTTGTGAGCCGGTGGATGAGTCCCAGTTGGATGTGGTTACTG CTCTGAGCGGAAGTGGACCGGCCTATGTATTCGTGATGATTGAGGCCTTG GCGGATGGAGCCGTTCACATGGGCATGCCCAGGGATCTGGCCTATCGTTT GGCATCGCAAACAGTCCTGGGCGCAGGTCACATGGTGCGGGACAGTGGTA TGCATCCCGGACAACTCAAGGATGGGGTCACAAGTCCGGCGGGATCGACA GCAGCGGCACTCAGACAACTCGAGCTGTCAGGTTTTCGGGCTGCGGTGTC TGGAGCGGTGGAACAGGCGACTCTGCGATGCCGGCAAATCTCGGGAAAGA CGAAGTAGGCACATAGGATTATCATATACATATACGTACATTGGGGTGGG TCAATTTTGTTATTAAAGTTATAGTAGTTAAAGGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5840-RA | 1426 | CG5840-RA | 230..1215 | 1..986 | 4915 | 99.8 | Plus |
CG5840-RB | 1263 | CG5840-RB | 231..1052 | 165..986 | 4095 | 99.8 | Plus |
CG5840.a | 1200 | CG5840.a | 168..989 | 165..986 | 4095 | 99.8 | Plus |
CG5840-RB | 1263 | CG5840-RB | 1..165 | 1..165 | 825 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 13360360..13361028 | 165..833 | 3225 | 98.8 | Plus |
chr3R | 27901430 | chr3R | 13360015..13360180 | 1..166 | 815 | 99.4 | Plus |
chr3R | 27901430 | chr3R | 13361096..13361251 | 829..984 | 765 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 17536032..17536700 | 165..833 | 3330 | 99.9 | Plus |
3R | 32079331 | 3R | 17535687..17535852 | 1..166 | 830 | 100 | Plus |
3R | 32079331 | 3R | 17536768..17536925 | 829..986 | 790 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 17276863..17277531 | 165..833 | 3330 | 99.8 | Plus |
3R | 31820162 | 3R | 17276518..17276683 | 1..166 | 830 | 100 | Plus |
3R | 31820162 | 3R | 17277599..17277756 | 829..986 | 790 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 13361099..13361251 | 832..984 | 99 | Plus | |
chr3R | 13360015..13360179 | 1..165 | 99 | -> | Plus |
chr3R | 13360361..13361026 | 166..831 | 98 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5840-RA | 1..822 | 87..908 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5840-RA | 1..822 | 87..908 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5840-RA | 1..822 | 87..908 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5840-RA | 1..822 | 87..908 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
P5cr-2-RA | 1..822 | 87..908 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5840-RA | 1..984 | 1..984 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5840-RA | 1..984 | 1..984 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5840-RA | 3..986 | 1..984 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5840-RA | 1..984 | 1..984 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
P5cr-2-RA | 3..986 | 1..984 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17535687..17535851 | 1..165 | 100 | -> | Plus |
3R | 17536033..17536698 | 166..831 | 99 | -> | Plus |
3R | 17536771..17536923 | 832..984 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17535687..17535851 | 1..165 | 100 | -> | Plus |
3R | 17536033..17536698 | 166..831 | 99 | -> | Plus |
3R | 17536771..17536923 | 832..984 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17535687..17535851 | 1..165 | 100 | -> | Plus |
3R | 17536033..17536698 | 166..831 | 99 | -> | Plus |
3R | 17536771..17536923 | 832..984 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 13361409..13361573 | 1..165 | 100 | -> | Plus |
arm_3R | 13361755..13362420 | 166..831 | 99 | -> | Plus |
arm_3R | 13362493..13362645 | 832..984 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17276864..17277529 | 166..831 | 99 | -> | Plus |
3R | 17277602..17277754 | 832..984 | 100 | Plus | |
3R | 17276518..17276682 | 1..165 | 100 | -> | Plus |
Translation from 86 to 907
> RE58687.pep MSAIGKIGFLGGGNMAKALAKGFLAAGLAKPNTLIASVHPADKLSLQSFQ SLGVETVIKNAPVVQQSDVVFVSVKPQVVPSVLSEIQPLSSGKLFLSVAM GITLSTIESSLSPQARVIRVMPNLPAVVCSGCSVFVRGSKATDADADITQ KLLQSVGTCEPVDESQLDVVTALSGSGPAYVFVMIEALADGAVHMGMPRD LAYRLASQTVLGAGHMVRDSGMHPGQLKDGVTSPAGSTAAALRQLELSGF RAAVSGAVEQATLRCRQISGKTK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16410-PA | 273 | GF16410-PA | 1..271 | 1..271 | 1322 | 93.7 | Plus |
Dana\GF18595-PA | 280 | GF18595-PA | 7..280 | 6..271 | 466 | 35.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22275-PA | 273 | GG22275-PA | 1..272 | 1..272 | 1389 | 98.9 | Plus |
Dere\GG23118-PA | 280 | GG23118-PA | 7..280 | 6..271 | 459 | 34.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13554-PA | 273 | GH13554-PA | 1..269 | 1..269 | 1143 | 79.9 | Plus |
Dgri\GH18149-PA | 280 | GH18149-PA | 7..280 | 6..271 | 462 | 36.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
P5cr-2-PA | 273 | CG5840-PA | 1..273 | 1..273 | 1342 | 100 | Plus |
P5cr-2-PD | 252 | CG5840-PD | 2..252 | 23..273 | 1223 | 99.2 | Plus |
P5cr-2-PC | 252 | CG5840-PC | 2..252 | 23..273 | 1223 | 99.2 | Plus |
P5cr-2-PB | 174 | CG5840-PB | 1..174 | 100..273 | 866 | 100 | Plus |
P5cr-PA | 280 | CG6009-PA | 7..280 | 6..271 | 454 | 35.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24792-PA | 273 | GI24792-PA | 1..271 | 1..271 | 1140 | 80.8 | Plus |
Dmoj\GI23448-PA | 280 | GI23448-PA | 7..280 | 6..271 | 458 | 35.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23580-PA | 258 | GL23580-PA | 1..257 | 15..271 | 1153 | 84.8 | Plus |
Dper\GL13575-PA | 280 | GL13575-PA | 7..280 | 6..271 | 470 | 37.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19170-PA | 272 | GA19170-PA | 1..271 | 1..271 | 1217 | 85.2 | Plus |
Dpse\GA19292-PA | 280 | GA19292-PA | 7..280 | 6..271 | 470 | 37.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15240-PA | 273 | GM15240-PA | 1..272 | 1..272 | 1378 | 98.2 | Plus |
Dsec\GM23296-PA | 280 | GM23296-PA | 7..280 | 6..271 | 445 | 35 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19166-PA | 273 | GD19166-PA | 1..272 | 1..272 | 1378 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24440-PA | 273 | GJ24440-PA | 1..271 | 1..271 | 1140 | 81.2 | Plus |
Dvir\GJ23775-PA | 280 | GJ23775-PA | 7..280 | 6..271 | 457 | 35.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11036-PA | 272 | GK11036-PA | 1..272 | 1..271 | 1081 | 79 | Plus |
Dwil\GK13573-PA | 280 | GK13573-PA | 7..280 | 6..271 | 465 | 36.2 | Plus |
Dwil\GK22849-PA | 129 | GK22849-PA | 3..96 | 147..238 | 182 | 43.6 | Plus |
Translation from 86 to 907
> RE58687.hyp MSAIGKIGFLGGGNMAKALAKGFLAAGLAKPNTLIASVHPADKLSLQSFQ SLGVETVIKNAPVVQQSDVVFVSVKPQVVPSVLSEIQPLSSGKLFLSVAM GITLSTIESSLSPQARVIRVMPNLPAVVCSGCSVFVRGSKATDADADITQ KLLQSVGTCEPVDESQLDVVTALSGSGPAYVFVMIEALADGAVHMGMPRD LAYRLASQTVLGAGHMVRDSGMHPGQLKDGVTSPAGSTAAALRQLELSGF RAAVSGAVEQATLRCRQISGKTK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
P5cr-2-PA | 273 | CG5840-PA | 1..273 | 1..273 | 1342 | 100 | Plus |
P5cr-2-PD | 252 | CG5840-PD | 2..252 | 23..273 | 1223 | 99.2 | Plus |
P5cr-2-PC | 252 | CG5840-PC | 2..252 | 23..273 | 1223 | 99.2 | Plus |
P5cr-2-PB | 174 | CG5840-PB | 1..174 | 100..273 | 866 | 100 | Plus |
P5cr-PA | 280 | CG6009-PA | 7..280 | 6..271 | 454 | 35.9 | Plus |