Clone RE58687 Report

Search the DGRC for RE58687

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:586
Well:87
Vector:pFlc-1
Associated Gene/TranscriptP5cr-2-RA
Protein status:RE58687.pep: gold
Sequenced Size:1000

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5840 2002-01-01 Sim4 clustering to Release 2
CG5840 2003-08-11 Blastp of sequenced clone
CG5840 2008-04-29 Release 5.5 accounting
CG5840 2008-08-15 Release 5.9 accounting
CG5840 2008-12-18 5.12 accounting

Clone Sequence Records

RE58687.complete Sequence

1000 bp (1000 high quality bases) assembled on 2003-08-11

GenBank Submission: BT010232

> RE58687.complete
CAACGCCGGCGGCGGGCGCACAGTTGCCGTTCCACCAGCAGAAAGTTCAG
TACTCACAGTCCGCGGACTTTTTAACCCATTAACTAATGTCGGCAATCGG
AAAGATCGGATTCCTGGGAGGCGGGAATATGGCCAAGGCTTTGGCTAAGG
GTTTCCTAGCGGCCGGCCTGGCCAAACCCAATACCCTGATAGCCAGCGTC
CATCCGGCAGATAAGCTCTCCCTGCAGTCCTTTCAATCCCTGGGAGTGGA
AACAGTGATCAAGAATGCACCCGTTGTGCAGCAATCGGATGTGGTCTTCG
TGTCCGTGAAACCCCAAGTGGTTCCCTCGGTTTTGTCGGAGATTCAGCCA
TTGAGCTCGGGCAAACTATTCCTTTCCGTGGCCATGGGCATCACGTTGTC
CACCATCGAGTCCAGTTTATCTCCACAAGCTCGCGTCATCCGTGTGATGC
CCAATCTGCCGGCTGTCGTGTGTTCCGGTTGTTCGGTTTTCGTTCGCGGA
TCCAAGGCCACAGATGCAGATGCGGATATTACCCAGAAGCTGCTGCAGTC
CGTGGGCACTTGTGAGCCGGTGGATGAGTCCCAGTTGGATGTGGTTACTG
CTCTGAGCGGAAGTGGACCGGCCTATGTATTCGTGATGATTGAGGCCTTG
GCGGATGGAGCCGTTCACATGGGCATGCCCAGGGATCTGGCCTATCGTTT
GGCATCGCAAACAGTCCTGGGCGCAGGTCACATGGTGCGGGACAGTGGTA
TGCATCCCGGACAACTCAAGGATGGGGTCACAAGTCCGGCGGGATCGACA
GCAGCGGCACTCAGACAACTCGAGCTGTCAGGTTTTCGGGCTGCGGTGTC
TGGAGCGGTGGAACAGGCGACTCTGCGATGCCGGCAAATCTCGGGAAAGA
CGAAGTAGGCACATAGGATTATCATATACATATACGTACATTGGGGTGGG
TCAATTTTGTTATTAAAGTTATAGTAGTTAAAGGAAAAAAAAAAAAAAAA

RE58687.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG5840-RA 1426 CG5840-RA 230..1215 1..986 4915 99.8 Plus
CG5840-RB 1263 CG5840-RB 231..1052 165..986 4095 99.8 Plus
CG5840.a 1200 CG5840.a 168..989 165..986 4095 99.8 Plus
CG5840-RB 1263 CG5840-RB 1..165 1..165 825 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13360360..13361028 165..833 3225 98.8 Plus
chr3R 27901430 chr3R 13360015..13360180 1..166 815 99.4 Plus
chr3R 27901430 chr3R 13361096..13361251 829..984 765 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:06:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17536032..17536700 165..833 3330 99.9 Plus
3R 32079331 3R 17535687..17535852 1..166 830 100 Plus
3R 32079331 3R 17536768..17536925 829..986 790 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17276863..17277531 165..833 3330 99.8 Plus
3R 31820162 3R 17276518..17276683 1..166 830 100 Plus
3R 31820162 3R 17277599..17277756 829..986 790 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:17:45 has no hits.

RE58687.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:18:29 Download gff for RE58687.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13361099..13361251 832..984 99   Plus
chr3R 13360015..13360179 1..165 99 -> Plus
chr3R 13360361..13361026 166..831 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:26:30 Download gff for RE58687.complete
Subject Subject Range Query Range Percent Splice Strand
CG5840-RA 1..822 87..908 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:54 Download gff for RE58687.complete
Subject Subject Range Query Range Percent Splice Strand
CG5840-RA 1..822 87..908 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:36:57 Download gff for RE58687.complete
Subject Subject Range Query Range Percent Splice Strand
CG5840-RA 1..822 87..908 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:26 Download gff for RE58687.complete
Subject Subject Range Query Range Percent Splice Strand
CG5840-RA 1..822 87..908 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:14:44 Download gff for RE58687.complete
Subject Subject Range Query Range Percent Splice Strand
P5cr-2-RA 1..822 87..908 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:08:01 Download gff for RE58687.complete
Subject Subject Range Query Range Percent Splice Strand
CG5840-RA 1..984 1..984 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:54 Download gff for RE58687.complete
Subject Subject Range Query Range Percent Splice Strand
CG5840-RA 1..984 1..984 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:36:57 Download gff for RE58687.complete
Subject Subject Range Query Range Percent Splice Strand
CG5840-RA 3..986 1..984 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:26 Download gff for RE58687.complete
Subject Subject Range Query Range Percent Splice Strand
CG5840-RA 1..984 1..984 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:14:44 Download gff for RE58687.complete
Subject Subject Range Query Range Percent Splice Strand
P5cr-2-RA 3..986 1..984 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:18:29 Download gff for RE58687.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17535687..17535851 1..165 100 -> Plus
3R 17536033..17536698 166..831 99 -> Plus
3R 17536771..17536923 832..984 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:18:29 Download gff for RE58687.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17535687..17535851 1..165 100 -> Plus
3R 17536033..17536698 166..831 99 -> Plus
3R 17536771..17536923 832..984 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:18:29 Download gff for RE58687.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17535687..17535851 1..165 100 -> Plus
3R 17536033..17536698 166..831 99 -> Plus
3R 17536771..17536923 832..984 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:36:57 Download gff for RE58687.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13361409..13361573 1..165 100 -> Plus
arm_3R 13361755..13362420 166..831 99 -> Plus
arm_3R 13362493..13362645 832..984 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:16 Download gff for RE58687.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17276864..17277529 166..831 99 -> Plus
3R 17277602..17277754 832..984 100   Plus
3R 17276518..17276682 1..165 100 -> Plus

RE58687.pep Sequence

Translation from 86 to 907

> RE58687.pep
MSAIGKIGFLGGGNMAKALAKGFLAAGLAKPNTLIASVHPADKLSLQSFQ
SLGVETVIKNAPVVQQSDVVFVSVKPQVVPSVLSEIQPLSSGKLFLSVAM
GITLSTIESSLSPQARVIRVMPNLPAVVCSGCSVFVRGSKATDADADITQ
KLLQSVGTCEPVDESQLDVVTALSGSGPAYVFVMIEALADGAVHMGMPRD
LAYRLASQTVLGAGHMVRDSGMHPGQLKDGVTSPAGSTAAALRQLELSGF
RAAVSGAVEQATLRCRQISGKTK*

RE58687.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16410-PA 273 GF16410-PA 1..271 1..271 1322 93.7 Plus
Dana\GF18595-PA 280 GF18595-PA 7..280 6..271 466 35.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22275-PA 273 GG22275-PA 1..272 1..272 1389 98.9 Plus
Dere\GG23118-PA 280 GG23118-PA 7..280 6..271 459 34.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13554-PA 273 GH13554-PA 1..269 1..269 1143 79.9 Plus
Dgri\GH18149-PA 280 GH18149-PA 7..280 6..271 462 36.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
P5cr-2-PA 273 CG5840-PA 1..273 1..273 1342 100 Plus
P5cr-2-PD 252 CG5840-PD 2..252 23..273 1223 99.2 Plus
P5cr-2-PC 252 CG5840-PC 2..252 23..273 1223 99.2 Plus
P5cr-2-PB 174 CG5840-PB 1..174 100..273 866 100 Plus
P5cr-PA 280 CG6009-PA 7..280 6..271 454 35.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24792-PA 273 GI24792-PA 1..271 1..271 1140 80.8 Plus
Dmoj\GI23448-PA 280 GI23448-PA 7..280 6..271 458 35.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23580-PA 258 GL23580-PA 1..257 15..271 1153 84.8 Plus
Dper\GL13575-PA 280 GL13575-PA 7..280 6..271 470 37.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19170-PA 272 GA19170-PA 1..271 1..271 1217 85.2 Plus
Dpse\GA19292-PA 280 GA19292-PA 7..280 6..271 470 37.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15240-PA 273 GM15240-PA 1..272 1..272 1378 98.2 Plus
Dsec\GM23296-PA 280 GM23296-PA 7..280 6..271 445 35 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19166-PA 273 GD19166-PA 1..272 1..272 1378 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24440-PA 273 GJ24440-PA 1..271 1..271 1140 81.2 Plus
Dvir\GJ23775-PA 280 GJ23775-PA 7..280 6..271 457 35.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:14:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11036-PA 272 GK11036-PA 1..272 1..271 1081 79 Plus
Dwil\GK13573-PA 280 GK13573-PA 7..280 6..271 465 36.2 Plus
Dwil\GK22849-PA 129 GK22849-PA 3..96 147..238 182 43.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:14:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25476-PA 273 GE25476-PA 1..272 1..272 1352 96.3 Plus
Dyak\GE25577-PA 280 GE25577-PA 7..280 6..271 457 35.5 Plus

RE58687.hyp Sequence

Translation from 86 to 907

> RE58687.hyp
MSAIGKIGFLGGGNMAKALAKGFLAAGLAKPNTLIASVHPADKLSLQSFQ
SLGVETVIKNAPVVQQSDVVFVSVKPQVVPSVLSEIQPLSSGKLFLSVAM
GITLSTIESSLSPQARVIRVMPNLPAVVCSGCSVFVRGSKATDADADITQ
KLLQSVGTCEPVDESQLDVVTALSGSGPAYVFVMIEALADGAVHMGMPRD
LAYRLASQTVLGAGHMVRDSGMHPGQLKDGVTSPAGSTAAALRQLELSGF
RAAVSGAVEQATLRCRQISGKTK*

RE58687.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
P5cr-2-PA 273 CG5840-PA 1..273 1..273 1342 100 Plus
P5cr-2-PD 252 CG5840-PD 2..252 23..273 1223 99.2 Plus
P5cr-2-PC 252 CG5840-PC 2..252 23..273 1223 99.2 Plus
P5cr-2-PB 174 CG5840-PB 1..174 100..273 866 100 Plus
P5cr-PA 280 CG6009-PA 7..280 6..271 454 35.9 Plus