Clone RE59129 Report

Search the DGRC for RE59129

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:591
Well:29
Vector:pFlc-1
Associated Gene/TranscriptEloB-RA
Protein status:RE59129.pep: gold
Preliminary Size:790
Sequenced Size:1244

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4204 2002-01-01 Sim4 clustering to Release 2
CG4204 2003-01-01 Sim4 clustering to Release 3
Elongin-B 2008-04-29 Release 5.5 accounting
Elongin-B 2008-08-15 Release 5.9 accounting
Elongin-B 2008-12-18 5.12 accounting

Clone Sequence Records

RE59129.complete Sequence

1244 bp (1244 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113507

> RE59129.complete
ACTATCGATGCGACCATCGATGGTTTGACAGCTCTAATTAGTTGAGAAAG
CAGCAGCAAAAGGCTAGAAAAAATCGTAAAACTACGAAAACCTACAAGTG
GGGGGCAACCGAGGAAGCTGTTGCACAAACATACACACTCACGCACGCTC
ATCGTACCGCGAACCGCACGCCACGCCCACCTGCGCCCGCCCCCAACTCC
GGTCGAGCGGCACAGAGCAAAAAATAGAAGCGCCCAGCAGCGGTGGTGCA
AGCGAAGTAGGAAAATTCCAGCCGATCGAAACGTCCGCCCGCGACCGCCA
AAGGAAGCGCCACCCACGCCGTCAGTTGCCGAACACAGCGCACTAGCCCA
CGCACCTGGTTAACCCACATCCGCGTAGCAGCCTCAGTCGCAGCCAGCGC
CACAAACTCCTCAATATGGACGTGTTCCTTATGATCAGGCGGCAAAAGAC
CACCATCTTCACGGACGCCAAGGAGAACACAACGGTGGCCGAGCTGAAGC
GAATGATTGAGGGCATACTAAAGGTGCAGCCCGTGGACCAGCGGTTATAC
AATCAGGACAACGATGTCATGGAGGACGACAGCACGTTGCAGGACTACGG
CGTGACGGTGTCCACGGCCAAGGCGCAGGCTCCGGCACAGCTGGGCTTGA
CATTCAGGAACGAGGTGGGCGACTTTGAGACACTGGACATGACACCCTAC
TCGGCACCACCAGACTTACCCGAAGTCATGAAAAACCAAGAGGCCTCGAA
CGGACAGGAGCAGGTGGCATAAGGATGCAGCCACAGCAGTCAGTCAGTCA
ATCACCCCTACGAGAACAACAAACAGCAGCAAACACATCATCAAAATCAA
CAGCAGCAGCAAATCGAGACAAAATAAATCCGCTAACTCTGTCGCTCGCT
TGTCCCACGCAAACGAAATGTATGAAATTGAAATCGAAGTTGATGGTCGG
ACCGGACGAAGGAGGAGGAAGATCTATTTGTCTGCGATTCTCAACTTCCC
AGCGTGGTGAAGAAGCAAAAGCTGCCGTCTCAACTGCAATAGCTAAATAT
GCATTTTTCGTTGTTAATAGCAAGGAACAATTAATTTACTATGGTTCCGA
CACAAAATTGAACTTTGGAATGGGATTGATAATATTCGGCTTTAATTTTA
CCCTAACCCCTTGATTGTTTCTTTTTAATGAAATTTATACGAATTTGTTG
AGAAAATACACAAAGTCATAAAAACAATAAAAAAAAAAAAAAAA

RE59129.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:54
Subject Length Description Subject Range Query Range Score Percent Strand
Elongin-B-RA 1459 Elongin-B-RA 112..1340 1..1229 6145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16402136..16402708 1228..656 2865 100 Minus
chr3R 27901430 chr3R 16403367..16403785 419..1 2095 100 Minus
chr3R 27901430 chr3R 16402827..16402973 658..512 735 100 Minus
chr3R 27901430 chr3R 16403052..16403147 513..418 480 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:06:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20578221..20578794 1229..656 2870 100 Minus
3R 32079331 3R 20579453..20579871 419..1 2095 100 Minus
3R 32079331 3R 20578913..20579059 658..512 735 100 Minus
3R 32079331 3R 20579138..20579233 513..418 480 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20319052..20319625 1229..656 2870 100 Minus
3R 31820162 3R 20320284..20320702 419..1 2095 100 Minus
3R 31820162 3R 20319744..20319890 658..512 735 100 Minus
3R 31820162 3R 20319969..20320064 513..418 480 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:45:40 has no hits.

RE59129.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:46:48 Download gff for RE59129.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16402828..16402972 513..657 100 <- Minus
chr3R 16403053..16403146 419..512 100 <- Minus
chr3R 16403368..16403785 1..418 100   Minus
chr3R 16402136..16402706 658..1228 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:26:46 Download gff for RE59129.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-B-RA 1..357 416..772 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:55:33 Download gff for RE59129.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-B-RA 1..357 416..772 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:22:21 Download gff for RE59129.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-B-RA 1..357 416..772 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:48:50 Download gff for RE59129.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-B-RA 1..357 416..772 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:19:51 Download gff for RE59129.complete
Subject Subject Range Query Range Percent Splice Strand
EloB-RA 1..357 416..772 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:34:48 Download gff for RE59129.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-B-RA 1..1228 1..1228 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:55:33 Download gff for RE59129.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-B-RA 1..1228 1..1228 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:22:21 Download gff for RE59129.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-B-RA 1..1207 22..1228 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:48:50 Download gff for RE59129.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-B-RA 1..1228 1..1228 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:19:51 Download gff for RE59129.complete
Subject Subject Range Query Range Percent Splice Strand
EloB-RA 1..1207 22..1228 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:46:48 Download gff for RE59129.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20578222..20578792 658..1228 100 <- Minus
3R 20578914..20579058 513..657 100 <- Minus
3R 20579139..20579232 419..512 100 <- Minus
3R 20579454..20579871 1..418 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:46:48 Download gff for RE59129.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20578222..20578792 658..1228 100 <- Minus
3R 20578914..20579058 513..657 100 <- Minus
3R 20579139..20579232 419..512 100 <- Minus
3R 20579454..20579871 1..418 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:46:48 Download gff for RE59129.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20578222..20578792 658..1228 100 <- Minus
3R 20578914..20579058 513..657 100 <- Minus
3R 20579139..20579232 419..512 100 <- Minus
3R 20579454..20579871 1..418 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:22:21 Download gff for RE59129.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16403944..16404514 658..1228 100 <- Minus
arm_3R 16404636..16404780 513..657 100 <- Minus
arm_3R 16404861..16404954 419..512 100 <- Minus
arm_3R 16405176..16405593 1..418 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:20:41 Download gff for RE59129.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20319053..20319623 658..1228 100 <- Minus
3R 20319745..20319889 513..657 100 <- Minus
3R 20319970..20320063 419..512 100 <- Minus
3R 20320285..20320702 1..418 100   Minus

RE59129.pep Sequence

Translation from 415 to 771

> RE59129.pep
MDVFLMIRRQKTTIFTDAKENTTVAELKRMIEGILKVQPVDQRLYNQDND
VMEDDSTLQDYGVTVSTAKAQAPAQLGLTFRNEVGDFETLDMTPYSAPPD
LPEVMKNQEASNGQEQVA*

RE59129.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18332-PA 118 GF18332-PA 1..118 1..118 601 96.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15357-PA 118 GG15357-PA 1..118 1..118 616 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16190-PA 118 GH16190-PA 1..118 1..118 566 91.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
EloB-PA 118 CG4204-PA 1..118 1..118 598 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22177-PA 152 GI22177-PA 36..152 2..118 562 90.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13928-PA 118 GL13928-PA 1..118 1..118 586 94.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26968-PA 118 GA26968-PA 1..118 1..118 586 94.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23182-PA 118 GM23182-PA 1..118 1..118 616 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20055-PA 118 GD20055-PA 1..118 1..118 616 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24297-PA 118 GJ24297-PA 1..118 1..118 576 92.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22717-PA 118 GK22717-PA 1..118 1..118 599 94.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25062-PA 118 GE25062-PA 1..118 1..118 613 99.2 Plus

RE59129.hyp Sequence

Translation from 774 to 1163

> RE59129.hyp
MQPQQSVSQSPLREQQTAANTSSKSTAAANRDKINPLTLSLACPTQTKCM
KLKSKLMVGPDEGGGRSICLRFSTSQRGEEAKAAVSTAIAKYAFFVVNSK
EQLIYYGSDTKLNFGMGLIIFGFNFTLTP*
Sequence RE59129.hyp has no blast hits.