Clone RE59131 Report

Search the DGRC for RE59131

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:591
Well:31
Vector:pFlc-1
Associated Gene/TranscriptRpL31-RA
Protein status:RE59131.pep: gold
Sequenced Size:524

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1821 2002-01-01 Sim4 clustering to Release 2
CG1821 2002-04-26 Blastp of sequenced clone
CG1821 2003-01-01 Sim4 clustering to Release 3
RpL31 2008-04-29 Release 5.5 accounting
RpL31 2008-08-15 Release 5.9 accounting
RpL31 2008-12-18 5.12 accounting

Clone Sequence Records

RE59131.complete Sequence

524 bp (524 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113508

> RE59131.complete
TCTTCTTCTATCCTTTTCTTTTCGCTGCGTTTCCGGAAGAGGATATTGAG
TAGCACCGTTTCGGGCTAAACAGCACAATGACCAAGACCAAGGGTGAGAA
AATCAACAAATCCGCGATCAACGAAGTCGTGACGCGCGAGTGCACCATTC
ACTTGGCCAAGCGTGTCCACAACATCGGCTTCAAGAAGCGCGCACCCCGC
GCCATCAAGGAGATCCGCAAGTTCGCCGAGCGGGAGATGGGCACCACCGA
TGTGAGGATCGACACCCGTCTGAACAAGCACATCTGGTCCAAGGGTATCA
GGTCCACTCCATTCCGCATTCGCGTGCGCCTGGCGCGTCGCCGCAACGAC
GATGAGGACTCCCCCAACAAGCTGTACACTTACGTGACCTATGTGCCGGT
GTCCACGTTCAAGAACTTGCAGACCGAGAATGTCGAGTCCAGCGACGACT
AAGCAACGTAATTGACGGCCAAGAAAACACGGTTAATAAAAAGTAATTTT
TATTTAGCAAAAAAAAAAAAAAAA

RE59131.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:48:56
Subject Length Description Subject Range Query Range Score Percent Strand
RpL31-RA 668 RpL31-RA 140..661 1..522 2565 99.4 Plus
RpL31.b 753 RpL31.b 268..750 40..522 2370 99.3 Plus
RpL31-RB 530 RpL31-RB 45..527 40..522 2370 99.3 Plus
RpL31.b 753 RpL31.b 11..52 1..42 210 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5474940..5475203 40..303 1320 100 Plus
chr2R 21145070 chr2R 5475269..5475477 299..507 1045 100 Plus
chr2R 21145070 chr2R 5474683..5474724 1..42 210 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:06:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:02:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9587445..9587708 40..303 1320 100 Plus
2R 25286936 2R 9587774..9587997 299..522 1075 98.7 Plus
2R 25286936 2R 9587188..9587229 1..42 210 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9588644..9588907 40..303 1320 100 Plus
2R 25260384 2R 9588973..9589196 299..522 1075 98.6 Plus
2R 25260384 2R 9588387..9588428 1..42 210 100 Plus
Blast to na_te.dros performed 2019-03-15 20:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 1805..1866 68..128 109 66.1 Plus

RE59131.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:03:45 Download gff for RE59131.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5474683..5474723 1..41 100 -> Plus
chr2R 5474942..5475201 42..301 100 -> Plus
chr2R 5475272..5475477 302..508 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:26:47 Download gff for RE59131.complete
Subject Subject Range Query Range Percent Splice Strand
RpL31-RA 1..375 78..452 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:19:15 Download gff for RE59131.complete
Subject Subject Range Query Range Percent Splice Strand
RpL31-RA 1..375 78..452 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:02:10 Download gff for RE59131.complete
Subject Subject Range Query Range Percent Splice Strand
RpL31-RC 1..375 78..452 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:03:26 Download gff for RE59131.complete
Subject Subject Range Query Range Percent Splice Strand
RpL31-RA 1..375 78..452 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:27:49 Download gff for RE59131.complete
Subject Subject Range Query Range Percent Splice Strand
RpL31-RC 1..375 78..452 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:19:25 Download gff for RE59131.complete
Subject Subject Range Query Range Percent Splice Strand
RpL31-RA 6..512 1..508 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:19:15 Download gff for RE59131.complete
Subject Subject Range Query Range Percent Splice Strand
RpL31-RA 6..512 1..508 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:02:10 Download gff for RE59131.complete
Subject Subject Range Query Range Percent Splice Strand
RpL31-RA 1..502 6..508 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:03:26 Download gff for RE59131.complete
Subject Subject Range Query Range Percent Splice Strand
RpL31-RA 6..512 1..508 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:27:49 Download gff for RE59131.complete
Subject Subject Range Query Range Percent Splice Strand
RpL31-RA 1..502 6..508 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:45 Download gff for RE59131.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9587777..9587982 302..508 99   Plus
2R 9587188..9587228 1..41 100 -> Plus
2R 9587447..9587706 42..301 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:45 Download gff for RE59131.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9587777..9587982 302..508 99   Plus
2R 9587188..9587228 1..41 100 -> Plus
2R 9587447..9587706 42..301 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:45 Download gff for RE59131.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9587777..9587982 302..508 99   Plus
2R 9587188..9587228 1..41 100 -> Plus
2R 9587447..9587706 42..301 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:02:10 Download gff for RE59131.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5474693..5474733 1..41 100 -> Plus
arm_2R 5474952..5475211 42..301 100 -> Plus
arm_2R 5475282..5475487 302..508 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:39:27 Download gff for RE59131.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9588646..9588905 42..301 100 -> Plus
2R 9588976..9589181 302..508 99   Plus
2R 9588387..9588427 1..41 100 -> Plus

RE59131.pep Sequence

Translation from 77 to 451

> RE59131.pep
MTKTKGEKINKSAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFA
EREMGTTDVRIDTRLNKHIWSKGIRSTPFRIRVRLARRRNDDEDSPNKLY
TYVTYVPVSTFKNLQTENVESSDD*

RE59131.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12477-PA 124 GF12477-PA 1..124 1..124 644 98.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24089-PA 124 GG24089-PA 1..124 1..124 649 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22931-PA 124 GH22931-PA 1..124 1..124 551 93.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
RpL31-PB 124 CG1821-PB 1..124 1..124 639 100 Plus
RpL31-PC 124 CG1821-PC 1..124 1..124 639 100 Plus
RpL31-PA 124 CG1821-PA 1..124 1..124 639 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18417-PA 124 GI18417-PA 1..124 1..124 543 92.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17146-PA 124 GL17146-PA 1..124 1..124 648 99.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14837-PA 124 GA14837-PA 1..124 1..124 648 99.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21136-PA 124 GM21136-PA 1..124 1..124 649 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10666-PA 124 GD10666-PA 1..124 1..124 649 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\RpL31-PA 124 GJ21503-PA 1..124 1..124 561 95.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15946-PA 124 GK15946-PA 1..124 1..124 569 96 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL31-PA 124 GE19289-PA 1..124 1..124 649 100 Plus

RE59131.hyp Sequence

Translation from 77 to 451

> RE59131.hyp
MTKTKGEKINKSAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFA
EREMGTTDVRIDTRLNKHIWSKGIRSTPFRIRVRLARRRNDDEDSPNKLY
TYVTYVPVSTFKNLQTENVESSDD*

RE59131.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
RpL31-PA 124 CG1821-PA 1..124 1..124 639 100 Plus
RpL31-PB 124 CG1821-PB 1..124 1..124 639 100 Plus
RpL31-PC 124 CG1821-PC 1..124 1..124 639 100 Plus