BDGP Sequence Production Resources |
Search the DGRC for RE59131
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 591 |
Well: | 31 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpL31-RA |
Protein status: | RE59131.pep: gold |
Sequenced Size: | 524 |
Gene | Date | Evidence |
---|---|---|
CG1821 | 2002-01-01 | Sim4 clustering to Release 2 |
CG1821 | 2002-04-26 | Blastp of sequenced clone |
CG1821 | 2003-01-01 | Sim4 clustering to Release 3 |
RpL31 | 2008-04-29 | Release 5.5 accounting |
RpL31 | 2008-08-15 | Release 5.9 accounting |
RpL31 | 2008-12-18 | 5.12 accounting |
524 bp (524 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113508
> RE59131.complete TCTTCTTCTATCCTTTTCTTTTCGCTGCGTTTCCGGAAGAGGATATTGAG TAGCACCGTTTCGGGCTAAACAGCACAATGACCAAGACCAAGGGTGAGAA AATCAACAAATCCGCGATCAACGAAGTCGTGACGCGCGAGTGCACCATTC ACTTGGCCAAGCGTGTCCACAACATCGGCTTCAAGAAGCGCGCACCCCGC GCCATCAAGGAGATCCGCAAGTTCGCCGAGCGGGAGATGGGCACCACCGA TGTGAGGATCGACACCCGTCTGAACAAGCACATCTGGTCCAAGGGTATCA GGTCCACTCCATTCCGCATTCGCGTGCGCCTGGCGCGTCGCCGCAACGAC GATGAGGACTCCCCCAACAAGCTGTACACTTACGTGACCTATGTGCCGGT GTCCACGTTCAAGAACTTGCAGACCGAGAATGTCGAGTCCAGCGACGACT AAGCAACGTAATTGACGGCCAAGAAAACACGGTTAATAAAAAGTAATTTT TATTTAGCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL31-RA | 668 | RpL31-RA | 140..661 | 1..522 | 2565 | 99.4 | Plus |
RpL31.b | 753 | RpL31.b | 268..750 | 40..522 | 2370 | 99.3 | Plus |
RpL31-RB | 530 | RpL31-RB | 45..527 | 40..522 | 2370 | 99.3 | Plus |
RpL31.b | 753 | RpL31.b | 11..52 | 1..42 | 210 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 5474940..5475203 | 40..303 | 1320 | 100 | Plus |
chr2R | 21145070 | chr2R | 5475269..5475477 | 299..507 | 1045 | 100 | Plus |
chr2R | 21145070 | chr2R | 5474683..5474724 | 1..42 | 210 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\Tom | 7060 | Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). | 1805..1866 | 68..128 | 109 | 66.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 5474683..5474723 | 1..41 | 100 | -> | Plus |
chr2R | 5474942..5475201 | 42..301 | 100 | -> | Plus |
chr2R | 5475272..5475477 | 302..508 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL31-RA | 1..375 | 78..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL31-RA | 1..375 | 78..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL31-RC | 1..375 | 78..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL31-RA | 1..375 | 78..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL31-RC | 1..375 | 78..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL31-RA | 6..512 | 1..508 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL31-RA | 6..512 | 1..508 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL31-RA | 1..502 | 6..508 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL31-RA | 6..512 | 1..508 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL31-RA | 1..502 | 6..508 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9587777..9587982 | 302..508 | 99 | Plus | |
2R | 9587188..9587228 | 1..41 | 100 | -> | Plus |
2R | 9587447..9587706 | 42..301 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9587777..9587982 | 302..508 | 99 | Plus | |
2R | 9587188..9587228 | 1..41 | 100 | -> | Plus |
2R | 9587447..9587706 | 42..301 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9587777..9587982 | 302..508 | 99 | Plus | |
2R | 9587188..9587228 | 1..41 | 100 | -> | Plus |
2R | 9587447..9587706 | 42..301 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 5474693..5474733 | 1..41 | 100 | -> | Plus |
arm_2R | 5474952..5475211 | 42..301 | 100 | -> | Plus |
arm_2R | 5475282..5475487 | 302..508 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9588646..9588905 | 42..301 | 100 | -> | Plus |
2R | 9588976..9589181 | 302..508 | 99 | Plus | |
2R | 9588387..9588427 | 1..41 | 100 | -> | Plus |
Translation from 77 to 451
> RE59131.pep MTKTKGEKINKSAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFA EREMGTTDVRIDTRLNKHIWSKGIRSTPFRIRVRLARRRNDDEDSPNKLY TYVTYVPVSTFKNLQTENVESSDD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12477-PA | 124 | GF12477-PA | 1..124 | 1..124 | 644 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24089-PA | 124 | GG24089-PA | 1..124 | 1..124 | 649 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22931-PA | 124 | GH22931-PA | 1..124 | 1..124 | 551 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL31-PB | 124 | CG1821-PB | 1..124 | 1..124 | 639 | 100 | Plus |
RpL31-PC | 124 | CG1821-PC | 1..124 | 1..124 | 639 | 100 | Plus |
RpL31-PA | 124 | CG1821-PA | 1..124 | 1..124 | 639 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18417-PA | 124 | GI18417-PA | 1..124 | 1..124 | 543 | 92.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17146-PA | 124 | GL17146-PA | 1..124 | 1..124 | 648 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14837-PA | 124 | GA14837-PA | 1..124 | 1..124 | 648 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21136-PA | 124 | GM21136-PA | 1..124 | 1..124 | 649 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10666-PA | 124 | GD10666-PA | 1..124 | 1..124 | 649 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\RpL31-PA | 124 | GJ21503-PA | 1..124 | 1..124 | 561 | 95.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15946-PA | 124 | GK15946-PA | 1..124 | 1..124 | 569 | 96 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpL31-PA | 124 | GE19289-PA | 1..124 | 1..124 | 649 | 100 | Plus |
Translation from 77 to 451
> RE59131.hyp MTKTKGEKINKSAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFA EREMGTTDVRIDTRLNKHIWSKGIRSTPFRIRVRLARRRNDDEDSPNKLY TYVTYVPVSTFKNLQTENVESSDD*