Clone RE59202 Report

Search the DGRC for RE59202

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:592
Well:2
Vector:pFlc-1
Associated Gene/TranscriptCG12546-RA
Protein status:RE59202.pep: gold
Preliminary Size:390
Sequenced Size:504

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12546 2002-01-01 Sim4 clustering to Release 2
CG12546 2002-04-26 Blastp of sequenced clone
CG14452 2008-04-29 Release 5.5 accounting
CG12546 2008-08-15 Release 5.9 accounting
CG12546 2008-12-18 5.12 accounting

Clone Sequence Records

RE59202.complete Sequence

504 bp (504 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113509

> RE59202.complete
AATAAGACATTCAGCATGCGCTTCTCGATCGTAATTGTTCTTTCCGTCCT
AGGATGCCTCCTGCTTAGCCAGGAGGGCAGTAGCAGCACATCTACATCCT
CGACGACGACCACAACCACCGACTCCTCTGCCACCACTACCACGGCTTCG
TCCGCCACCACTACCACCACTGCCTCTTCCGCATCCACCACGACCACTGC
CTCCTCCTCATCCTCTTCCTCTGCGGAGGCCAGGAGGCGCAGGCGCGCCC
GTCGCCGTCGTCTGGCGCGTGAGAGGCAACGAAGGGAGCGCAGAAGGCAG
CGCAGGACTCAGAGGCTGCGCCAGCAACTGGAGAATCAACGTCGACAGAT
CAACCAGCTGAGCGGATGAAGGTCTTCGGAAAGACTCGGCTTATGACAAT
TTAGGAAAAGCTGTTGTAAATATGTGAAAGCTAAATTCTTTCATTGTTCA
AGTTCGCCAAGATAATAAAACATTTGATTGTACATTCTGAAAAAAAAAAA
AAAA

RE59202.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG12546-RA 494 CG12546-RA 5..491 4..490 2435 100 Plus
CG14452-RA 485 CG14452-RA 10..485 7..482 2380 100 Plus
CG32453-RA 434 CG32453-RA 63..266 70..273 685 90.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22682220..22682705 489..4 2430 100 Minus
chr3L 24539361 chr3L 22684865..22685347 7..489 2415 100 Plus
chr3L 24539361 chr3L 22681159..22681362 273..70 665 90.3 Minus
chr3L 24539361 chr3L 22686205..22686408 70..273 665 90.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:06:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:24:47
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22693315..22693801 490..4 2435 100 Minus
3L 28110227 3L 22695961..22696444 7..490 2420 100 Plus
3L 28110227 3L 22692255..22692458 273..70 665 90.3 Minus
3L 28110227 3L 22697301..22697504 70..273 665 90.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22686415..22686901 490..4 2435 100 Minus
3L 28103327 3L 22689061..22689544 7..490 2420 100 Plus
3L 28103327 3L 22690401..22690604 70..273 685 90.3 Plus
3L 28103327 3L 22685355..22685558 273..70 685 90.3 Minus
Blast to na_te.dros performed on 2019-03-15 20:24:48 has no hits.

RE59202.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:25:33 Download gff for RE59202.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22682220..22682501 208..489 100 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:26:51 Download gff for RE59202.complete
Subject Subject Range Query Range Percent Splice Strand
CG14452-RA 1..354 16..369 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:37 Download gff for RE59202.complete
Subject Subject Range Query Range Percent Splice Strand
CG12546-RA 1..354 16..369 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:12:29 Download gff for RE59202.complete
Subject Subject Range Query Range Percent Splice Strand
CG12546-RA 1..354 16..369 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:01 Download gff for RE59202.complete
Subject Subject Range Query Range Percent Splice Strand
CG14452-RA 1..354 16..369 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:21:11 Download gff for RE59202.complete
Subject Subject Range Query Range Percent Splice Strand
CG12546-RA 1..354 16..369 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:30 Download gff for RE59202.complete
Subject Subject Range Query Range Percent Splice Strand
CG12546-RA 3..490 1..489 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:37 Download gff for RE59202.complete
Subject Subject Range Query Range Percent Splice Strand
CG12546-RA 3..490 1..489 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:12:29 Download gff for RE59202.complete
Subject Subject Range Query Range Percent Splice Strand
CG12546-RA 10..489 1..481 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:01 Download gff for RE59202.complete
Subject Subject Range Query Range Percent Splice Strand
CG12546-RA 3..490 1..489 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:21:11 Download gff for RE59202.complete
Subject Subject Range Query Range Percent Splice Strand
CG12546-RA 10..489 1..481 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:33 Download gff for RE59202.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22693316..22693802 1..489 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:33 Download gff for RE59202.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22693316..22693802 1..489 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:33 Download gff for RE59202.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22693316..22693802 1..489 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:12:29 Download gff for RE59202.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22686416..22686902 1..489 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:17:05 Download gff for RE59202.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22686416..22686902 1..489 99   Minus

RE59202.hyp Sequence

Translation from 3 to 368

> RE59202.hyp
KTFSMRFSIVIVLSVLGCLLLSQEGSSSTSTSSTTTTTTDSSATTTTASS
ATTTTTASSASTTTTASSSSSSSAEARRRRRARRRRLARERQRRERRRQR
RTQRLRQQLENQRRQINQLSG*

RE59202.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG14452-PA 117 CG14452-PA 1..117 5..121 547 100 Plus
CG12546-PA 117 CG12546-PA 1..117 5..121 547 100 Plus
CG32453-PB 120 CG32453-PB 1..120 5..121 408 74.2 Plus
CG32453-PA 120 CG32453-PA 1..120 5..121 408 74.2 Plus
CG14454-PB 120 CG14454-PB 1..120 5..121 408 74.2 Plus

RE59202.pep Sequence

Translation from 15 to 368

> RE59202.pep
MRFSIVIVLSVLGCLLLSQEGSSSTSTSSTTTTTTDSSATTTTASSATTT
TTASSASTTTTASSSSSSSAEARRRRRARRRRLARERQRRERRRQRRTQR
LRQQLENQRRQINQLSG*

RE59202.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG12546-PA 117 CG12546-PA 1..117 1..117 547 100 Plus
CG14452-PA 117 CG14452-PA 1..117 1..117 547 100 Plus
CG14454-PB 120 CG14454-PB 1..120 1..117 408 74.2 Plus
CG14454-PA 120 CG14454-PA 1..120 1..117 408 74.2 Plus
CG32453-PB 120 CG32453-PB 1..120 1..117 408 74.2 Plus
CG32453-PA 120 CG32453-PA 1..120 1..117 408 74.2 Plus
CG14453-PA 133 CG14453-PA 1..133 1..117 289 54.1 Plus
ng1-PA 107 CG10781-PA 1..104 1..100 199 42.3 Plus
ng2-PA 112 CG14266-PA 1..112 1..106 199 42 Plus
CG14265-PB 119 CG14265-PB 1..118 1..109 192 40.7 Plus
CG12491-PA 157 CG12491-PA 63..154 22..111 192 48.9 Plus
CG34105-PA 157 CG34105-PA 63..154 22..111 192 48.9 Plus
CG32071-PA 150 CG32071-PA 11..127 1..110 185 39.3 Plus
CG13560-PB 181 CG13560-PB 85..177 21..111 178 43.2 Plus
CG13560-PA 181 CG13560-PA 85..177 21..111 178 43.2 Plus
ng3-PB 146 CG10788-PB 1..120 1..116 173 39.5 Plus
CG13560-PB 181 CG13560-PB 100..180 22..102 172 45.7 Plus
CG13560-PA 181 CG13560-PA 100..180 22..102 172 45.7 Plus
CG13560-PB 181 CG13560-PB 85..177 13..104 169 43.2 Plus
CG13560-PA 181 CG13560-PA 85..177 13..104 169 43.2 Plus
CG7377-PA 94 CG7377-PA 1..92 1..93 161 41.8 Plus
CG33268-PA 94 CG33268-PA 1..92 1..93 159 41.8 Plus
CG32188-PA 105 CG32188-PA 1..102 1..103 157 41.7 Plus
CG32189-PA 105 CG32189-PA 1..102 1..103 157 41.7 Plus
CG33267-PB 94 CG33267-PB 1..92 1..93 154 40.8 Plus
CG12522-PA 137 CG12522-PA 1..110 1..92 153 39.1 Plus
CG14237-PB 121 CG14237-PB 10..101 8..108 147 39.6 Plus
CG32198-PB 136 CG32198-PB 31..111 22..102 144 42 Plus
CG15741-PA 135 CG15741-PA 39..130 18..103 143 34.8 Plus
CG14850-PA 158 CG14850-PA 65..154 23..111 143 38.9 Plus
CG14850-PA 158 CG14850-PA 71..154 21..104 139 40.2 Plus
CG14852-PA 174 CG14852-PA 71..169 20..116 138 35.3 Plus
CG14850-PA 158 CG14850-PA 49..156 17..108 137 35.2 Plus
CG13135-PC 132 CG13135-PC 48..129 20..104 135 37.6 Plus
CG13135-PA 132 CG13135-PA 48..129 20..104 135 37.6 Plus
CG42815-PA 101 CG32186-PA 1..98 1..97 133 32.7 Plus