Clone RE59232 Report

Search the DGRC for RE59232

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:592
Well:32
Vector:pFlc-1
Associated Gene/TranscriptCG31249-RA
Protein status:RE59232.pep: gold
Preliminary Size:1843
Sequenced Size:1191

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7477 2002-01-01 Sim4 clustering to Release 2
CG31249 2002-05-30 Blastp of sequenced clone
CG31249 2003-01-01 Sim4 clustering to Release 3
CG31249 2008-04-29 Release 5.5 accounting
CG31249 2008-08-15 Release 5.9 accounting
CG31249 2008-12-18 5.12 accounting

Clone Sequence Records

RE59232.complete Sequence

1191 bp (1191 high quality bases) assembled on 2002-05-30

GenBank Submission: AY118399

> RE59232.complete
CTTAAATTTGGGCGATAAGAATAAGCACAGCCGGCTGTAACATTTTTTGT
AAATTAACAGAGCGAATCGATTTTTGTATAGTAATCCGTTGAAAGCATGC
TGTCGCTCAAGATGAAACTCGAGGTACTGGGTCGTCCCGATGTTGACATC
CCGGTGGTGATGAGCGACCGCAAGGAATTCGCCAACACAGTCCTCTGGTT
GGAGGACCAGAAGATCCGGCTTTACTCCATAGAGGATCGCTGTAAGCTGC
GCACTGTCGACAACCCTGAGATCTGGAAGGAGGGTTACTTAAAGTACTGT
GCCGATTTGAGCATGCCGCCCCTGGAGACGCGGCAGGAGCAGCTGGCCTG
GATTGTCAGCTATGCTGTGCGCCTGGACTTCCTCGATGATCCTGATCAGT
TTGCCTCGATTAACACCAAACAGGTGCCACCCCAAAGCAATGGCAAGCAG
TCCCAACAAAGGGTCCAGGCTATTTTCGATGGAAATATTAATACTCAGGA
AAAAGCGTTCGTGGATGGAGTCCGGCTGCTGGCCAGCAAACTGAATGTGC
CGCACCACCCGAACCATCTGTTGCAGCTGGAGGCTATCGCTCGCGTGGTG
CACGAACGCCTCTCGCCCGCCGCCAAGGATCGCAAGCCGGTAGTGGGTAA
ACCCTTCCCTTTTGACAAGGGAAACGACGTCGTCTCGTCCAACGACTCTG
CCCTGGACCTGCCCATGCGCATACTACGTCTTCTCCAGATCCAGAGCCTA
CGCGAGCTGCAGACACACATCAATGAGACCATTGTGGCGGTGCAGAACAT
CACGGCCAATCCAAAGACTGATACCAAGCTGGGGAAAGTGGGATTCTAGA
CGATTAACAGTAAAGGAACGCAATCGACACAATATAACATAAAAGGACAT
AAAGAACATAAAAGTTTTAAAATTGCATCTATAAAATATCCTTTAAAGCC
AAGCAACAACATTTAGCAGAAATCAATAGATAGATCAACAGCCAAGCTAT
GAACAAGCAAACACCTTTTTTGAAAGCTATAAAATAAGAATCCTGTTGAT
ATTTTATAATATTATTATTAATACAAACATATGTTTATTTATGATCCTCT
TTCAAAAGATGCAATATTGTGTATGCCTATGTAATTAATTTATTTAAAAT
AAATCATAAATTCATTAAAAAAAAGAAAAAAAAAAAAAAAA

RE59232.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG31249-RA 1237 CG31249-RA 72..1237 1..1166 5830 100 Plus
CG31249.a 1165 CG31249.a 5..1165 1..1166 5730 99.5 Plus
CG31360-RA 735 CG31360-RA 614..735 1169..1048 610 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:42:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13510027..13510701 1169..494 3300 99.6 Minus
chr3R 27901430 chr3R 13510853..13511180 493..166 1625 99.7 Minus
chr3R 27901430 chr3R 13511238..13511403 166..1 815 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:06:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17685686..17686361 1169..494 3380 100 Minus
3R 32079331 3R 17686511..17686838 493..166 1640 100 Minus
3R 32079331 3R 17686896..17687061 166..1 830 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17426517..17427192 1169..494 3380 100 Minus
3R 31820162 3R 17427342..17427669 493..166 1640 100 Minus
3R 31820162 3R 17427727..17427892 166..1 830 100 Minus
Blast to na_te.dros performed 2019-03-16 03:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 8024..8328 867..1163 157 58 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 920..1188 882..1161 150 56.9 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1132..1250 1028..1149 132 62.9 Plus
invader3 5484 invader3 INVADER3 5484bp 4987..5091 1126..1029 130 65.4 Minus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1039..1183 1023..1167 129 58.8 Plus
Dbuz\BuT2 2775 Dbuz\BuT2 BUT2 2775bp 284..333 1092..1041 129 75 Minus
Tc3 1743 Tc3 TC3 1743bp 231..320 1010..1096 126 64.4 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1109..1256 1016..1166 125 58.2 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1104..1243 1028..1167 122 58.7 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 132..199 1169..1101 117 65.2 Minus
Porto1 4682 Porto1 DOC5 4682bp 2778..2908 864..998 116 60.4 Plus
Tabor 7345 Tabor TABOR 7345bp 6749..6832 1102..1015 115 62.5 Minus
springer 7546 springer SPRINGER 7546bp Derived from BACR06P08 by Sue Celniker, 29 March 2001. 501..625 1173..1049 111 56.3 Minus

RE59232.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:43:13 Download gff for RE59232.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13510066..13510701 494..1130 95 <- Minus
chr3R 13510853..13511179 167..493 99 <- Minus
chr3R 13511238..13511403 1..166 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:26:53 Download gff for RE59232.complete
Subject Subject Range Query Range Percent Splice Strand
CG31249-RA 1..753 97..849 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:36:00 Download gff for RE59232.complete
Subject Subject Range Query Range Percent Splice Strand
CG31249-RA 1..753 97..849 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:48:14 Download gff for RE59232.complete
Subject Subject Range Query Range Percent Splice Strand
CG31249-RA 1..753 97..849 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:27:34 Download gff for RE59232.complete
Subject Subject Range Query Range Percent Splice Strand
CG31249-RA 1..753 97..849 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:12:26 Download gff for RE59232.complete
Subject Subject Range Query Range Percent Splice Strand
CG31249-RA 1..753 97..849 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:07:48 Download gff for RE59232.complete
Subject Subject Range Query Range Percent Splice Strand
CG31249-RA 1..1174 1..1175 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:36:00 Download gff for RE59232.complete
Subject Subject Range Query Range Percent Splice Strand
CG31249-RA 1..1166 1..1166 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:48:14 Download gff for RE59232.complete
Subject Subject Range Query Range Percent Splice Strand
CG31249-RA 11..1176 1..1166 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:27:34 Download gff for RE59232.complete
Subject Subject Range Query Range Percent Splice Strand
CG31249-RA 1..1174 1..1175 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:12:26 Download gff for RE59232.complete
Subject Subject Range Query Range Percent Splice Strand
CG31249-RA 11..1176 1..1166 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:43:13 Download gff for RE59232.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17685677..17686361 494..1175 99 <- Minus
3R 17686511..17686837 167..493 100 <- Minus
3R 17686896..17687061 1..166 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:43:13 Download gff for RE59232.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17685677..17686361 494..1175 99 <- Minus
3R 17686511..17686837 167..493 100 <- Minus
3R 17686896..17687061 1..166 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:43:13 Download gff for RE59232.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17685677..17686361 494..1175 99 <- Minus
3R 17686511..17686837 167..493 100 <- Minus
3R 17686896..17687061 1..166 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:48:14 Download gff for RE59232.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13511399..13512083 494..1175 99 <- Minus
arm_3R 13512233..13512559 167..493 100 <- Minus
arm_3R 13512618..13512783 1..166 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:00:05 Download gff for RE59232.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17426508..17427192 494..1175 99 <- Minus
3R 17427342..17427668 167..493 100 <- Minus
3R 17427727..17427892 1..166 100   Minus

RE59232.pep Sequence

Translation from 96 to 848

> RE59232.pep
MLSLKMKLEVLGRPDVDIPVVMSDRKEFANTVLWLEDQKIRLYSIEDRCK
LRTVDNPEIWKEGYLKYCADLSMPPLETRQEQLAWIVSYAVRLDFLDDPD
QFASINTKQVPPQSNGKQSQQRVQAIFDGNINTQEKAFVDGVRLLASKLN
VPHHPNHLLQLEAIARVVHERLSPAAKDRKPVVGKPFPFDKGNDVVSSND
SALDLPMRILRLLQIQSLRELQTHINETIVAVQNITANPKTDTKLGKVGF
*

RE59232.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:23:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17173-PA 247 GF17173-PA 2..246 4..249 1055 78.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:23:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16759-PA 247 GG16759-PA 2..246 4..249 1113 85.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19520-PA 248 GH19520-PA 2..247 4..249 880 66 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG31249-PA 250 CG31249-PA 1..250 1..250 1286 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22997-PA 248 GI22997-PA 2..247 4..249 907 67.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:23:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21702-PA 248 GL21702-PA 2..248 4..250 953 71.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:23:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16123-PA 248 GA16123-PA 2..248 4..250 948 71.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15348-PA 249 GM15348-PA 1..249 1..250 1204 91.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15096-PA 249 GD15096-PA 1..249 1..250 1226 92.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24590-PA 248 GJ24590-PA 2..247 4..249 919 70.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13788-PA 250 GK13788-PA 2..249 4..249 957 72.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25254-PA 247 GE25254-PA 2..246 4..249 1091 82.5 Plus

RE59232.hyp Sequence

Translation from 96 to 848

> RE59232.hyp
MLSLKMKLEVLGRPDVDIPVVMSDRKEFANTVLWLEDQKIRLYSIEDRCK
LRTVDNPEIWKEGYLKYCADLSMPPLETRQEQLAWIVSYAVRLDFLDDPD
QFASINTKQVPPQSNGKQSQQRVQAIFDGNINTQEKAFVDGVRLLASKLN
VPHHPNHLLQLEAIARVVHERLSPAAKDRKPVVGKPFPFDKGNDVVSSND
SALDLPMRILRLLQIQSLRELQTHINETIVAVQNITANPKTDTKLGKVGF
*

RE59232.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG31249-PA 250 CG31249-PA 1..250 1..250 1286 100 Plus