BDGP Sequence Production Resources |
Search the DGRC for RE59324
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 593 |
Well: | 24 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpS24-RA |
Protein status: | RE59324.pep: gold |
Sequenced Size: | 659 |
Gene | Date | Evidence |
---|---|---|
CG3751 | 2002-01-01 | Sim4 clustering to Release 2 |
CG3751 | 2002-04-26 | Blastp of sequenced clone |
CG3751 | 2003-01-01 | Sim4 clustering to Release 3 |
RpS24 | 2008-04-29 | Release 5.5 accounting |
RpS24 | 2008-08-15 | Release 5.9 accounting |
RpS24 | 2008-12-18 | 5.12 accounting |
659 bp (659 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113512
> RE59324.complete CTTTTTCTAATAAATCGCGTTCGCAAAACGACGTGTTTAAAACCTTTTCA AGTGTTTTAAAAGCTCCGTCAAAATGTCCGGTACAACCGCTACCATCCGC ACCCGCAAGTTCATGACCAACCGCCTGCTCGCCAGGAAACAGATGGTCTG CGATGTCCTCCACCCAGGATTGTCGTCCGTGAACAAGACCGAGATCCGCG AGAAGCTCGCCGCCATGTACAAGGTCACCCCCGATGTGGTCTTCGCCTTC GGATTCCGCACCAACTTCGGTGGCGGCCGCTCCACCGGCTTTGCCCTCAT CTACGACACCCTGGACTTCGCCAAGAAGTTCGAGCCCAAGTACCGCCTGG CCCGTCACGGCCTCTTCGAACAGAAGAAGCAGACCCGCAAGCAGCGCAAG GAGCGTCGCAACAGGATGAAGAAGGTGCGCGGTACTGCCAAGGCCAAGAT CGGCACTGGCAAGAAGTAAGCCTGATGGAGGAAAGCTCGTCTGCGGGCAT CGCCTGCTATTCCCAAAAGCTGCTGGTTATGCGTTAGTCAAACTTCTTTA CCAACCAATCAACAACCGACAAAACAAAATCAGTGTTTACTTTTGGAGCG GCTTTTGTTTGTAAACTAAGGAAATAAAACTCTAAAAGTATACAAAAAAA AAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS24-RA | 762 | RpS24-RA | 55..696 | 4..645 | 3195 | 99.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 18527050..18527629 | 64..643 | 99 | <- | Minus |
chr2R | 18527880..18527940 | 1..63 | 96 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS24-RA | 1..396 | 74..469 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS24-RA | 1..396 | 74..469 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS24-RA | 1..396 | 74..469 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS24-RA | 1..396 | 74..469 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS24-RA | 1..396 | 74..469 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS24-RA | 1..645 | 1..643 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS24-RA | 1..645 | 1..643 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS24-RA | 2..646 | 1..643 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS24-RA | 1..645 | 1..643 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS24-RA | 2..646 | 1..643 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22640526..22641105 | 64..643 | 99 | <- | Minus |
2R | 22641354..22641414 | 1..63 | 96 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22640526..22641105 | 64..643 | 99 | <- | Minus |
2R | 22641354..22641414 | 1..63 | 96 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22640526..22641105 | 64..643 | 99 | <- | Minus |
2R | 22641354..22641414 | 1..63 | 96 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 18528031..18528610 | 64..643 | 99 | <- | Minus |
arm_2R | 18528859..18528919 | 1..63 | 96 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22641725..22642304 | 64..643 | 99 | <- | Minus |
2R | 22642553..22642613 | 1..63 | 96 | Minus |
Translation from 73 to 468
> RE59324.pep MSGTTATIRTRKFMTNRLLARKQMVCDVLHPGLSSVNKTEIREKLAAMYK VTPDVVFAFGFRTNFGGGRSTGFALIYDTLDFAKKFEPKYRLARHGLFEQ KKQTRKQRKERRNRMKKVRGTAKAKIGTGKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13006-PA | 131 | GF13006-PA | 1..131 | 1..131 | 676 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21778-PA | 131 | GG21778-PA | 1..131 | 1..131 | 680 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20334-PA | 132 | GH20334-PA | 3..132 | 2..131 | 668 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS24-PA | 131 | CG3751-PA | 1..131 | 1..131 | 671 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20005-PA | 132 | GI20005-PA | 3..132 | 2..131 | 666 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10465-PA | 131 | GL10465-PA | 1..131 | 1..131 | 674 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17660-PA | 131 | GA17660-PA | 1..131 | 1..131 | 674 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15629-PA | 131 | GM15629-PA | 1..131 | 1..131 | 680 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25118-PA | 131 | GD25118-PA | 1..131 | 1..131 | 680 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21254-PA | 132 | GJ21254-PA | 3..132 | 2..131 | 671 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21430-PA | 131 | GK21430-PA | 1..131 | 1..131 | 670 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11854-PA | 131 | GE11854-PA | 1..131 | 1..131 | 680 | 100 | Plus |
Translation from 73 to 468
> RE59324.hyp MSGTTATIRTRKFMTNRLLARKQMVCDVLHPGLSSVNKTEIREKLAAMYK VTPDVVFAFGFRTNFGGGRSTGFALIYDTLDFAKKFEPKYRLARHGLFEQ KKQTRKQRKERRNRMKKVRGTAKAKIGTGKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS24-PA | 131 | CG3751-PA | 1..131 | 1..131 | 671 | 100 | Plus |