Clone RE59324 Report

Search the DGRC for RE59324

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:593
Well:24
Vector:pFlc-1
Associated Gene/TranscriptRpS24-RA
Protein status:RE59324.pep: gold
Sequenced Size:659

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3751 2002-01-01 Sim4 clustering to Release 2
CG3751 2002-04-26 Blastp of sequenced clone
CG3751 2003-01-01 Sim4 clustering to Release 3
RpS24 2008-04-29 Release 5.5 accounting
RpS24 2008-08-15 Release 5.9 accounting
RpS24 2008-12-18 5.12 accounting

Clone Sequence Records

RE59324.complete Sequence

659 bp (659 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113512

> RE59324.complete
CTTTTTCTAATAAATCGCGTTCGCAAAACGACGTGTTTAAAACCTTTTCA
AGTGTTTTAAAAGCTCCGTCAAAATGTCCGGTACAACCGCTACCATCCGC
ACCCGCAAGTTCATGACCAACCGCCTGCTCGCCAGGAAACAGATGGTCTG
CGATGTCCTCCACCCAGGATTGTCGTCCGTGAACAAGACCGAGATCCGCG
AGAAGCTCGCCGCCATGTACAAGGTCACCCCCGATGTGGTCTTCGCCTTC
GGATTCCGCACCAACTTCGGTGGCGGCCGCTCCACCGGCTTTGCCCTCAT
CTACGACACCCTGGACTTCGCCAAGAAGTTCGAGCCCAAGTACCGCCTGG
CCCGTCACGGCCTCTTCGAACAGAAGAAGCAGACCCGCAAGCAGCGCAAG
GAGCGTCGCAACAGGATGAAGAAGGTGCGCGGTACTGCCAAGGCCAAGAT
CGGCACTGGCAAGAAGTAAGCCTGATGGAGGAAAGCTCGTCTGCGGGCAT
CGCCTGCTATTCCCAAAAGCTGCTGGTTATGCGTTAGTCAAACTTCTTTA
CCAACCAATCAACAACCGACAAAACAAAATCAGTGTTTACTTTTGGAGCG
GCTTTTGTTTGTAAACTAAGGAAATAAAACTCTAAAAGTATACAAAAAAA
AAAAAAAAA

RE59324.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:55
Subject Length Description Subject Range Query Range Score Percent Strand
RpS24-RA 762 RpS24-RA 55..696 4..645 3195 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18527050..18527631 643..62 2865 99.5 Minus
chr2R 21145070 chr2R 18527880..18527939 63..4 300 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:06:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:46:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22640524..22641107 645..62 2905 99.8 Minus
2R 25286936 2R 22641354..22641413 63..4 300 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22641723..22642306 645..62 2905 99.8 Minus
2R 25260384 2R 22642553..22642612 63..4 300 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:46:40 has no hits.

RE59324.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:47:25 Download gff for RE59324.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18527050..18527629 64..643 99 <- Minus
chr2R 18527880..18527940 1..63 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:27:04 Download gff for RE59324.complete
Subject Subject Range Query Range Percent Splice Strand
RpS24-RA 1..396 74..469 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:55:36 Download gff for RE59324.complete
Subject Subject Range Query Range Percent Splice Strand
RpS24-RA 1..396 74..469 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:54:51 Download gff for RE59324.complete
Subject Subject Range Query Range Percent Splice Strand
RpS24-RA 1..396 74..469 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:48:55 Download gff for RE59324.complete
Subject Subject Range Query Range Percent Splice Strand
RpS24-RA 1..396 74..469 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:32:29 Download gff for RE59324.complete
Subject Subject Range Query Range Percent Splice Strand
RpS24-RA 1..396 74..469 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:34:51 Download gff for RE59324.complete
Subject Subject Range Query Range Percent Splice Strand
RpS24-RA 1..645 1..643 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:55:36 Download gff for RE59324.complete
Subject Subject Range Query Range Percent Splice Strand
RpS24-RA 1..645 1..643 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:54:51 Download gff for RE59324.complete
Subject Subject Range Query Range Percent Splice Strand
RpS24-RA 2..646 1..643 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:48:55 Download gff for RE59324.complete
Subject Subject Range Query Range Percent Splice Strand
RpS24-RA 1..645 1..643 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:32:29 Download gff for RE59324.complete
Subject Subject Range Query Range Percent Splice Strand
RpS24-RA 2..646 1..643 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:25 Download gff for RE59324.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22640526..22641105 64..643 99 <- Minus
2R 22641354..22641414 1..63 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:25 Download gff for RE59324.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22640526..22641105 64..643 99 <- Minus
2R 22641354..22641414 1..63 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:25 Download gff for RE59324.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22640526..22641105 64..643 99 <- Minus
2R 22641354..22641414 1..63 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:54:51 Download gff for RE59324.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18528031..18528610 64..643 99 <- Minus
arm_2R 18528859..18528919 1..63 96   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:20:44 Download gff for RE59324.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22641725..22642304 64..643 99 <- Minus
2R 22642553..22642613 1..63 96   Minus

RE59324.pep Sequence

Translation from 73 to 468

> RE59324.pep
MSGTTATIRTRKFMTNRLLARKQMVCDVLHPGLSSVNKTEIREKLAAMYK
VTPDVVFAFGFRTNFGGGRSTGFALIYDTLDFAKKFEPKYRLARHGLFEQ
KKQTRKQRKERRNRMKKVRGTAKAKIGTGKK*

RE59324.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13006-PA 131 GF13006-PA 1..131 1..131 676 99.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21778-PA 131 GG21778-PA 1..131 1..131 680 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:07:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20334-PA 132 GH20334-PA 3..132 2..131 668 98.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
RpS24-PA 131 CG3751-PA 1..131 1..131 671 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:07:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20005-PA 132 GI20005-PA 3..132 2..131 666 98.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10465-PA 131 GL10465-PA 1..131 1..131 674 98.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17660-PA 131 GA17660-PA 1..131 1..131 674 98.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15629-PA 131 GM15629-PA 1..131 1..131 680 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25118-PA 131 GD25118-PA 1..131 1..131 680 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21254-PA 132 GJ21254-PA 3..132 2..131 671 99.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21430-PA 131 GK21430-PA 1..131 1..131 670 98.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11854-PA 131 GE11854-PA 1..131 1..131 680 100 Plus

RE59324.hyp Sequence

Translation from 73 to 468

> RE59324.hyp
MSGTTATIRTRKFMTNRLLARKQMVCDVLHPGLSSVNKTEIREKLAAMYK
VTPDVVFAFGFRTNFGGGRSTGFALIYDTLDFAKKFEPKYRLARHGLFEQ
KKQTRKQRKERRNRMKKVRGTAKAKIGTGKK*

RE59324.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
RpS24-PA 131 CG3751-PA 1..131 1..131 671 100 Plus