Clone RE59371 Report

Search the DGRC for RE59371

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:593
Well:71
Vector:pFlc-1
Associated Gene/TranscriptCG12920-RA
Protein status:RE59371.pep: gold
Preliminary Size:1119
Sequenced Size:1320

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12920 2002-01-01 Sim4 clustering to Release 2
CG12920 2003-01-01 Sim4 clustering to Release 3
CG12920 2003-02-24 Blastp of sequenced clone
CG12920 2008-04-29 Release 5.5 accounting
CG12920 2008-08-15 Release 5.9 accounting
CG12920 2008-12-18 5.12 accounting

Clone Sequence Records

RE59371.complete Sequence

1320 bp (1320 high quality bases) assembled on 2003-02-24

GenBank Submission: BT004856

> RE59371.complete
ATCATTCGGTTCTGCAGTGACCAACCAAAGCCACAGGGATACCAGCTTTT
GCTCTTTACACCGCTACAACGCTAAACAATCATGCACAAGAACACCATTT
GGTACGGAGCTGTGCTCCTTGTCGTCTACTTCACGCTGGTGTTTTGCGAG
GAGACGAAGAACGAGGAGGCTCCGGCGCAATTGGATAACCAAGTGGAGGA
CACATGGGAAAATCTCGGCCGGGAGCTAATGGAGTTTGAGGGACGTACTC
GACGCCATCGTCACCACATGTTCTGGTATCGTCACCTATGGCCCATTGCC
ATTGCTTACTGGATCAAGGTGAAAGTGGTGATCGTATCCTTCTTTGTGGG
CAGTGCCATCTACTTGGGTCTGCGCTATTTCTGGCCCCATGCCAGGTGCA
ACCAGGAGATCATCCTTGATCATCCTCCTTCGTCTTTCTCTCATCACGAT
CACATTCCCTACTCTCTGGACCACGATCACTCGGAGCACTATGATGCTCC
TTCATCTTTTGACTCCGGCGCCAGTTTCGAGCCCTATTCCGGATACAGCA
GCTATGCTGGATCGGACATTGTCTCTGATGTGCATGGCGACTACCATAGC
GAATCTCCCTCTGGACCAAGTGGCCCATCTGGTCCCGTAGACACGCGCCG
TCGCGGACGCCGTAGCGCTGCAGATAACGCCCATTTGATCCAAGATGAGC
AGGAGGAAGAGCATGTGGAGATTGTGGATGAGGAAATTTCAGAGAGCGTG
GCTCGCCAAATGCCCGCCGAAGAGCAGATTGCCGATTTTATGTTCGCCTT
TTTGGGCCTGGACTCAAAGGCGTGCCGACGCCGATTTGTCTGCGAAATGG
AGTTTAGATCCAAGTTGAATCCCTTGACCAGCATGGCTTTCCGCATTGTG
GGTCGCGGTTTCTTTGAGAAGTACACCAATGCCAGAAATCCTATGGCCAG
GGCCACCAGCTTTGGCGAGTGTGCTGCCGTCAATCCCGAGTGCATTTTCG
TGGAGAACGACAACGGCGAGGAAAATCCGGAGTCGGAGGCACACCAGGAG
GCTGATCAGCAACAGGAGGAGCAGGCAGTCACCGAGGAATCTGCCGCTGA
GGATTCCCAGAATGAGATCAACCTCCAAGCCGAAAGGCGACGAGCCAAGC
ACAAGAATCGCAAGCTCAGCTCCATTGCCGAGCACATCCTGATGCAGTAG
AACAGCCTTGTCTAATTAATCTATTTAATTGTATTTATTTATTTTAGCTA
TAAGAGTGGATAACGAACACAAATAAACTTGCCTCAATCTATGTATGGAA
AGCGAAAAAAAAAAAAAAAA

RE59371.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:18:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG12920-RA 1344 CG12920-RA 30..1338 1..1309 6530 99.9 Plus
CG1371-RA 4085 CG1371-RA 3901..4085 1309..1125 910 99.4 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:47:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5958086..5958611 777..1302 2630 100 Plus
chr2R 21145070 chr2R 5957675..5958026 426..777 1760 100 Plus
chr2R 21145070 chr2R 5956655..5956931 1..277 1355 99.3 Plus
chr2R 21145070 chr2R 5957466..5957613 278..425 740 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:06:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10070540..10071072 777..1309 2650 99.8 Plus
2R 25286936 2R 10070129..10070480 426..777 1760 100 Plus
2R 25286936 2R 10069109..10069385 1..277 1385 100 Plus
2R 25286936 2R 10069920..10070067 278..425 740 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10071739..10072271 777..1309 2650 99.8 Plus
2R 25260384 2R 10071328..10071679 426..777 1760 100 Plus
2R 25260384 2R 10070308..10070584 1..277 1385 100 Plus
2R 25260384 2R 10071119..10071266 278..425 740 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:47:48 has no hits.

RE59371.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:48:44 Download gff for RE59371.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5956655..5956931 1..277 99 -> Plus
chr2R 5957466..5957613 278..425 100 -> Plus
chr2R 5957675..5958025 426..776 100 -> Plus
chr2R 5958086..5958613 777..1304 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:27:15 Download gff for RE59371.complete
Subject Subject Range Query Range Percent Splice Strand
CG12920-RA 1..1119 82..1200 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:48:10 Download gff for RE59371.complete
Subject Subject Range Query Range Percent Splice Strand
CG12920-RA 1..1119 82..1200 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:58:49 Download gff for RE59371.complete
Subject Subject Range Query Range Percent Splice Strand
CG12920-RA 1..1119 82..1200 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:39:32 Download gff for RE59371.complete
Subject Subject Range Query Range Percent Splice Strand
CG12920-RA 1..1119 82..1200 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:32:50 Download gff for RE59371.complete
Subject Subject Range Query Range Percent Splice Strand
CG12920-RA 1..1119 82..1200 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:00:23 Download gff for RE59371.complete
Subject Subject Range Query Range Percent Splice Strand
CG12920-RA 1..1304 1..1304 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:48:10 Download gff for RE59371.complete
Subject Subject Range Query Range Percent Splice Strand
CG12920-RA 1..1304 1..1304 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:58:49 Download gff for RE59371.complete
Subject Subject Range Query Range Percent Splice Strand
CG12920-RA 4..1307 1..1304 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:39:32 Download gff for RE59371.complete
Subject Subject Range Query Range Percent Splice Strand
CG12920-RA 1..1304 1..1304 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:32:50 Download gff for RE59371.complete
Subject Subject Range Query Range Percent Splice Strand
CG12920-RA 4..1307 1..1304 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:48:44 Download gff for RE59371.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10069109..10069385 1..277 100 -> Plus
2R 10069920..10070067 278..425 100 -> Plus
2R 10070129..10070479 426..776 100 -> Plus
2R 10070540..10071067 777..1304 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:48:44 Download gff for RE59371.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10069109..10069385 1..277 100 -> Plus
2R 10069920..10070067 278..425 100 -> Plus
2R 10070129..10070479 426..776 100 -> Plus
2R 10070540..10071067 777..1304 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:48:44 Download gff for RE59371.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10069109..10069385 1..277 100 -> Plus
2R 10069920..10070067 278..425 100 -> Plus
2R 10070129..10070479 426..776 100 -> Plus
2R 10070540..10071067 777..1304 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:58:49 Download gff for RE59371.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5956614..5956890 1..277 100 -> Plus
arm_2R 5957425..5957572 278..425 100 -> Plus
arm_2R 5957634..5957984 426..776 100 -> Plus
arm_2R 5958045..5958572 777..1304 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:09:54 Download gff for RE59371.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10070308..10070584 1..277 100 -> Plus
2R 10071119..10071266 278..425 100 -> Plus
2R 10071328..10071678 426..776 100 -> Plus
2R 10071739..10072266 777..1304 99   Plus

RE59371.pep Sequence

Translation from 81 to 1199

> RE59371.pep
MHKNTIWYGAVLLVVYFTLVFCEETKNEEAPAQLDNQVEDTWENLGRELM
EFEGRTRRHRHHMFWYRHLWPIAIAYWIKVKVVIVSFFVGSAIYLGLRYF
WPHARCNQEIILDHPPSSFSHHDHIPYSLDHDHSEHYDAPSSFDSGASFE
PYSGYSSYAGSDIVSDVHGDYHSESPSGPSGPSGPVDTRRRGRRSAADNA
HLIQDEQEEEHVEIVDEEISESVARQMPAEEQIADFMFAFLGLDSKACRR
RFVCEMEFRSKLNPLTSMAFRIVGRGFFEKYTNARNPMARATSFGECAAV
NPECIFVENDNGEENPESEAHQEADQQQEEQAVTEESAAEDSQNEINLQA
ERRRAKHKNRKLSSIAEHILMQ*

RE59371.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12015-PA 373 GF12015-PA 1..373 1..372 1571 80.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24135-PA 375 GG24135-PA 1..375 1..372 1629 88.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21918-PA 388 GH21918-PA 1..388 1..372 980 64.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG12920-PA 372 CG12920-PA 1..372 1..372 1990 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19268-PA 382 GI19268-PA 1..382 1..372 1154 66.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11517-PA 365 GL11517-PA 1..365 1..372 1333 75.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11909-PA 365 GA11909-PA 1..365 1..372 1335 76.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21180-PA 378 GM21180-PA 1..378 1..372 1965 96.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10712-PA 378 GD10712-PA 1..378 1..372 1971 97.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22144-PA 378 GJ22144-PA 1..378 1..372 1218 68.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20643-PA 356 GK20643-PA 1..356 1..372 1179 64.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19334-PA 379 GE19334-PA 1..378 1..371 1684 92.1 Plus

RE59371.hyp Sequence

Translation from 81 to 1199

> RE59371.hyp
MHKNTIWYGAVLLVVYFTLVFCEETKNEEAPAQLDNQVEDTWENLGRELM
EFEGRTRRHRHHMFWYRHLWPIAIAYWIKVKVVIVSFFVGSAIYLGLRYF
WPHARCNQEIILDHPPSSFSHHDHIPYSLDHDHSEHYDAPSSFDSGASFE
PYSGYSSYAGSDIVSDVHGDYHSESPSGPSGPSGPVDTRRRGRRSAADNA
HLIQDEQEEEHVEIVDEEISESVARQMPAEEQIADFMFAFLGLDSKACRR
RFVCEMEFRSKLNPLTSMAFRIVGRGFFEKYTNARNPMARATSFGECAAV
NPECIFVENDNGEENPESEAHQEADQQQEEQAVTEESAAEDSQNEINLQA
ERRRAKHKNRKLSSIAEHILMQ*

RE59371.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG12920-PA 372 CG12920-PA 1..372 1..372 1990 100 Plus