Clone RE59545 Report

Search the DGRC for RE59545

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:595
Well:45
Vector:pFlc-1
Associated Gene/TranscriptCG14812-RA
Protein status:RE59545.pep: gold
Preliminary Size:684
Sequenced Size:716

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14812 2002-01-01 Sim4 clustering to Release 2
CG14812 2002-04-26 Blastp of sequenced clone
CG14812 2008-04-29 Release 5.5 accounting
CG14812 2008-08-15 Release 5.9 accounting
CG14812 2008-12-18 5.12 accounting

Clone Sequence Records

RE59545.complete Sequence

716 bp (716 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113514

> RE59545.complete
GGTCCTGTTCTTGCTTTGTTTTTTCACTGCGGAAATAACGACGTCGTCCA
TGGAGCAGCAACTGGAGAAAGTCCTAGCGGAAATCGCCGCACGGCAGGAC
ACAGTGGGAGCTCTGCTGGCCAATCGCCAGGGATTGTGTTTGGGCACCAA
AGGAGACATTGATCCGAACGTGTCCGGCATCGGAATGGCCATTTCCGAGC
AGGTGGCCAAACTGGAGCTGAATGCCACGGCTCCTGCAACGATTTGCCTT
TACAGCGGAAACAAACGCTGTGTCATCCAGAAGGACGGCGAGATCACAGG
CGTTATCTTCAAGCAGCCGACGGGTACATCGGCGACCGCCCCCAGCAACT
AACGAAAGTTGGGGCCTCAATCGCAACTCTCAGGCCAAATACGCAAGTCA
AAATACGGATACGGATACAAAGCCAGATACAGATACTTATATCTTCCAAG
TCGCGCCCGCTTCGCTCGATTCGCCCGATGGTAGCGCCTGTTACATTTGT
CGCTCATTCTAACCGATAGCCATTACCATAAGCATTGTTTTGTACGACTC
GCATAGCATAAGCATTACGGATTACGCATTAAGCACTGCTGTTACTTGAT
CTTGTTTGTCTTAACCAGTCTAGCGTCATCAACATGTACATAAAGACTTT
GTACGATTAAGCCCCAGAAAGTAAACACAATGTACACCAATTAAAAAAAG
AAAAAAAAAAAAAAAA

RE59545.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812.a 1041 CG14812.a 30..724 1..695 3460 99.8 Plus
CG14812-RA 853 CG14812-RA 43..737 1..695 3460 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1751819..1752249 695..265 2155 100 Minus
chrX 22417052 chrX 1752404..1752521 264..147 590 100 Minus
chrX 22417052 chrX 1752711..1752794 84..1 405 98.8 Minus
chrX 22417052 chrX 1752579..1752640 146..85 310 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:06:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1857976..1858406 695..265 2155 100 Minus
X 23542271 X 1858561..1858678 264..147 590 100 Minus
X 23542271 X 1858868..1858951 84..1 405 98.8 Minus
X 23542271 X 1858736..1858797 146..85 310 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1866074..1866504 695..265 2155 100 Minus
X 23527363 X 1866659..1866776 264..147 590 100 Minus
X 23527363 X 1866966..1867049 84..1 405 98.8 Minus
X 23527363 X 1866834..1866895 146..85 310 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:25:03 has no hits.

RE59545.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:26:39 Download gff for RE59545.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1751812..1752249 265..700 99 <- Minus
chrX 1752404..1752521 147..264 100 <- Minus
chrX 1752579..1752640 85..146 100 <- Minus
chrX 1752711..1752794 1..84 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:27:22 Download gff for RE59545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 1..303 50..352 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:55:39 Download gff for RE59545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 1..303 50..352 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:20:28 Download gff for RE59545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 1..303 50..352 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:49:02 Download gff for RE59545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 1..303 50..352 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:49:09 Download gff for RE59545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 1..303 50..352 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:34:54 Download gff for RE59545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 1..699 1..700 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:55:39 Download gff for RE59545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 1..699 1..700 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:20:28 Download gff for RE59545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 46..744 1..700 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:49:02 Download gff for RE59545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 1..699 1..700 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:49:09 Download gff for RE59545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 21..719 1..700 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:26:39 Download gff for RE59545.complete
Subject Subject Range Query Range Percent Splice Strand
X 1857969..1858406 265..700 99 <- Minus
X 1858561..1858678 147..264 100 <- Minus
X 1858736..1858797 85..146 100 <- Minus
X 1858868..1858951 1..84 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:26:39 Download gff for RE59545.complete
Subject Subject Range Query Range Percent Splice Strand
X 1857969..1858406 265..700 99 <- Minus
X 1858561..1858678 147..264 100 <- Minus
X 1858736..1858797 85..146 100 <- Minus
X 1858868..1858951 1..84 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:26:39 Download gff for RE59545.complete
Subject Subject Range Query Range Percent Splice Strand
X 1857969..1858406 265..700 99 <- Minus
X 1858561..1858678 147..264 100 <- Minus
X 1858736..1858797 85..146 100 <- Minus
X 1858868..1858951 1..84 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:20:28 Download gff for RE59545.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1752002..1752439 265..700 99 <- Minus
arm_X 1752594..1752711 147..264 100 <- Minus
arm_X 1752769..1752830 85..146 100 <- Minus
arm_X 1752901..1752984 1..84 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:20:47 Download gff for RE59545.complete
Subject Subject Range Query Range Percent Splice Strand
X 1866067..1866504 265..700 99 <- Minus
X 1866659..1866776 147..264 100 <- Minus
X 1866834..1866895 85..146 100 <- Minus
X 1866966..1867049 1..84 98   Minus

RE59545.hyp Sequence

Translation from 0 to 351

> RE59545.hyp
VLFLLCFFTAEITTSSMEQQLEKVLAEIAARQDTVGALLANRQGLCLGTK
GDIDPNVSGIGMAISEQVAKLELNATAPATICLYSGNKRCVIQKDGEITG
VIFKQPTGTSATAPSN*

RE59545.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812-PB 100 CG14812-PB 1..100 17..116 502 100 Plus
CG14812-PA 100 CG14812-PA 1..100 17..116 502 100 Plus

RE59545.pep Sequence

Translation from 49 to 351

> RE59545.pep
MEQQLEKVLAEIAARQDTVGALLANRQGLCLGTKGDIDPNVSGIGMAISE
QVAKLELNATAPATICLYSGNKRCVIQKDGEITGVIFKQPTGTSATAPSN
*

RE59545.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21078-PA 100 GF21078-PA 1..88 1..88 402 88.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12679-PA 100 GG12679-PA 1..100 1..100 488 96 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17852-PA 99 GH17852-PA 1..89 1..89 397 84.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812-PB 100 CG14812-PB 1..100 1..100 502 100 Plus
CG14812-PA 100 CG14812-PA 1..100 1..100 502 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10992-PA 107 GI10992-PA 1..89 1..89 396 83.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26868-PA 103 GL26868-PA 1..97 1..91 342 73.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13265-PA 103 GA13265-PA 1..97 1..91 342 73.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18952-PA 100 GM18952-PA 1..100 1..100 491 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24627-PA 100 GD24627-PA 1..100 1..100 491 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19104-PA 99 GJ19104-PA 1..99 1..100 404 78 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19795-PA 101 GK19795-PA 1..97 1..97 369 73.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16509-PA 100 GE16509-PA 1..100 1..100 486 96 Plus