Clone RE59557 Report

Search the DGRC for RE59557

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:595
Well:57
Vector:pFlc-1
Associated Gene/TranscriptChrac-16-RA
Protein status:RE59557.pep: gold
Preliminary Size:641
Sequenced Size:696

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15736 2002-01-01 Sim4 clustering to Release 2
CG15736 2002-04-26 Blastp of sequenced clone
CG15736 2003-01-01 Sim4 clustering to Release 3
Chrac-16 2008-04-29 Release 5.5 accounting
Chrac-16 2008-08-15 Release 5.9 accounting
Chrac-16 2008-12-18 5.12 accounting

Clone Sequence Records

RE59557.complete Sequence

696 bp assembled on 2007-04-18

GenBank Submission: AY113515

> RE59557.complete
AGTTTCACAGCTCCACTTGTGAGCCCAGCTCTAAAACCAAAAAAATTCCC
AAGCCATAGTTTGCTTGGGAATTAAGTAAACAAATGGGCGAACCAAGGAG
CCAACCACCCGTGGAGCGTCCACCGACCGCGGAAACCTTTCTGCCCCTCA
GCCGCGTGCGAACGATCATGAAGAGCTCCATGGACACGGGCTTGATCACC
AACGAGGTGCTCTTCCTGATGACCAAGTGCACGGAGCTATTCGTTCGCCA
TTTGGCGGGCGCGGCATACACGGAGGAATTCGGCCAGCGACCGGGCGAAG
CGCTCAAGTACGAGCATCTCTCCCAGGTGGTCAATAAGAACAAGAATCTG
GAGTTTCTGCTGCAGATCGTGCCGCAAAAGATCCGTGTACACCAGTTCCA
GGAGATGCTGCGGCTAAATCGCTCCGCCGGCAGCGACGACGACGATGACG
ACGACGATGATGACGATGAAGAAGAGTCCGAATCGGAATCGGAGTCTGAT
GAATAGACGGTCATGCAGATGTTTATCTACACCGAAATTGAGTGGATGAT
CTCCATTCACCAAAACATCGACTGATTTTTTACGCCACCTTGCTATCTTT
AATTTTAGACTAGACGATAAGTATAAAATTGTTTATAGAACCACTGATTA
ATAAAGAAGCATAAGAGCACTGCGTCCTCCAAAAAAAAAAAAAAAA

RE59557.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
Chrac-16-RA 683 Chrac-16-RA 1..683 1..683 3415 100 Plus
regucalcin.a 1426 regucalcin.a 1332..1426 683..589 475 100 Minus
regucalcin-RC 1459 regucalcin-RC 1365..1459 683..589 475 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:01:20
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11908342..11909021 680..1 3370 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:06:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:01:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 12017274..12017956 683..1 3415 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 12025372..12026054 683..1 3415 100 Minus
Blast to na_te.dros performed 2019-03-16 15:01:19
Subject Length Description Subject Range Query Range Score Percent Strand
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 7909..7980 291..222 111 65.3 Minus

RE59557.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:02:03 Download gff for RE59557.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11908342..11909021 1..680 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:27:23 Download gff for RE59557.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-16-RA 1..423 84..506 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:04:05 Download gff for RE59557.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-16-RA 1..423 84..506 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:32:01 Download gff for RE59557.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-16-RA 1..423 84..506 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:05:28 Download gff for RE59557.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-16-RA 1..423 84..506 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:39:27 Download gff for RE59557.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-16-RA 1..423 84..506 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:29:46 Download gff for RE59557.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-16-RA 1..680 1..680 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:04:04 Download gff for RE59557.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-16-RA 1..680 1..680 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:32:01 Download gff for RE59557.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-16-RA 6..685 1..680 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:05:29 Download gff for RE59557.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-16-RA 1..680 1..680 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:39:27 Download gff for RE59557.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-16-RA 6..685 1..680 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:02:03 Download gff for RE59557.complete
Subject Subject Range Query Range Percent Splice Strand
X 12017277..12017956 1..680 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:02:03 Download gff for RE59557.complete
Subject Subject Range Query Range Percent Splice Strand
X 12017277..12017956 1..680 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:02:03 Download gff for RE59557.complete
Subject Subject Range Query Range Percent Splice Strand
X 12017277..12017956 1..680 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:32:01 Download gff for RE59557.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11911310..11911989 1..680 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:11 Download gff for RE59557.complete
Subject Subject Range Query Range Percent Splice Strand
X 12025375..12026054 1..680 100   Minus

RE59557.hyp Sequence

Translation from 83 to 505

> RE59557.hyp
MGEPRSQPPVERPPTAETFLPLSRVRTIMKSSMDTGLITNEVLFLMTKCT
ELFVRHLAGAAYTEEFGQRPGEALKYEHLSQVVNKNKNLEFLLQIVPQKI
RVHQFQEMLRLNRSAGSDDDDDDDDDDDEEESESESESDE*

RE59557.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Chrac-16-PB 140 CG15736-PB 1..140 1..140 720 100 Plus
Chrac-16-PA 140 CG15736-PA 1..140 1..140 720 100 Plus

RE59557.pep Sequence

Translation from 84 to 506

> RE59557.pep
MGEPRSQPPVERPPTAETFLPLSRVRTIMKSSMDTGLITNEVLFLMTKCT
ELFVRHLAGAAYTEEFGQRPGEALKYEHLSQVVNKNKNLEFLLQIVPQKI
RVHQFQEMLRLNRSAGSDDDDDDDDDDDEEESESESESDE*

RE59557.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:31:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19515-PA 133 GF19515-PA 9..113 12..113 420 76.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:31:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19565-PA 131 GG19565-PA 1..115 1..115 550 87.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:31:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24787-PA 127 GH24787-PA 16..126 21..131 425 72.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Chrac-16-PB 140 CG15736-PB 1..140 1..140 720 100 Plus
Chrac-16-PA 140 CG15736-PA 1..140 1..140 720 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:31:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21483-PA 131 GI21483-PA 9..130 10..140 474 71 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:31:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20264-PA 135 GL20264-PA 1..117 1..117 454 72.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:31:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13924-PA 135 GA13924-PA 1..117 1..117 454 72.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:31:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13228-PA 144 GM13228-PA 1..144 1..140 694 94.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15946-PA 141 GD15946-PA 1..141 1..140 706 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18514-PA 134 GJ18514-PA 10..134 11..135 450 74.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25044-PA 149 GK25044-PA 2..119 6..115 412 68.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16727-PA 131 GE16727-PA 1..115 1..115 554 88.7 Plus