BDGP Sequence Production Resources |
Search the DGRC for RE59557
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 595 |
Well: | 57 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Chrac-16-RA |
Protein status: | RE59557.pep: gold |
Preliminary Size: | 641 |
Sequenced Size: | 696 |
Gene | Date | Evidence |
---|---|---|
CG15736 | 2002-01-01 | Sim4 clustering to Release 2 |
CG15736 | 2002-04-26 | Blastp of sequenced clone |
CG15736 | 2003-01-01 | Sim4 clustering to Release 3 |
Chrac-16 | 2008-04-29 | Release 5.5 accounting |
Chrac-16 | 2008-08-15 | Release 5.9 accounting |
Chrac-16 | 2008-12-18 | 5.12 accounting |
696 bp assembled on 2007-04-18
GenBank Submission: AY113515
> RE59557.complete AGTTTCACAGCTCCACTTGTGAGCCCAGCTCTAAAACCAAAAAAATTCCC AAGCCATAGTTTGCTTGGGAATTAAGTAAACAAATGGGCGAACCAAGGAG CCAACCACCCGTGGAGCGTCCACCGACCGCGGAAACCTTTCTGCCCCTCA GCCGCGTGCGAACGATCATGAAGAGCTCCATGGACACGGGCTTGATCACC AACGAGGTGCTCTTCCTGATGACCAAGTGCACGGAGCTATTCGTTCGCCA TTTGGCGGGCGCGGCATACACGGAGGAATTCGGCCAGCGACCGGGCGAAG CGCTCAAGTACGAGCATCTCTCCCAGGTGGTCAATAAGAACAAGAATCTG GAGTTTCTGCTGCAGATCGTGCCGCAAAAGATCCGTGTACACCAGTTCCA GGAGATGCTGCGGCTAAATCGCTCCGCCGGCAGCGACGACGACGATGACG ACGACGATGATGACGATGAAGAAGAGTCCGAATCGGAATCGGAGTCTGAT GAATAGACGGTCATGCAGATGTTTATCTACACCGAAATTGAGTGGATGAT CTCCATTCACCAAAACATCGACTGATTTTTTACGCCACCTTGCTATCTTT AATTTTAGACTAGACGATAAGTATAAAATTGTTTATAGAACCACTGATTA ATAAAGAAGCATAAGAGCACTGCGTCCTCCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Chrac-16-RA | 683 | Chrac-16-RA | 1..683 | 1..683 | 3415 | 100 | Plus |
regucalcin.a | 1426 | regucalcin.a | 1332..1426 | 683..589 | 475 | 100 | Minus |
regucalcin-RC | 1459 | regucalcin-RC | 1365..1459 | 683..589 | 475 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 11908342..11909021 | 680..1 | 3370 | 99.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 12017274..12017956 | 683..1 | 3415 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 12025372..12026054 | 683..1 | 3415 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ZAM | 8435 | ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). | 7909..7980 | 291..222 | 111 | 65.3 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 11908342..11909021 | 1..680 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-16-RA | 1..423 | 84..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-16-RA | 1..423 | 84..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-16-RA | 1..423 | 84..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-16-RA | 1..423 | 84..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-16-RA | 1..423 | 84..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-16-RA | 1..680 | 1..680 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-16-RA | 1..680 | 1..680 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-16-RA | 6..685 | 1..680 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-16-RA | 1..680 | 1..680 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-16-RA | 6..685 | 1..680 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 12017277..12017956 | 1..680 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 12017277..12017956 | 1..680 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 12017277..12017956 | 1..680 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 11911310..11911989 | 1..680 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 12025375..12026054 | 1..680 | 100 | Minus |
Translation from 83 to 505
> RE59557.hyp MGEPRSQPPVERPPTAETFLPLSRVRTIMKSSMDTGLITNEVLFLMTKCT ELFVRHLAGAAYTEEFGQRPGEALKYEHLSQVVNKNKNLEFLLQIVPQKI RVHQFQEMLRLNRSAGSDDDDDDDDDDDEEESESESESDE*
Translation from 84 to 506
> RE59557.pep MGEPRSQPPVERPPTAETFLPLSRVRTIMKSSMDTGLITNEVLFLMTKCT ELFVRHLAGAAYTEEFGQRPGEALKYEHLSQVVNKNKNLEFLLQIVPQKI RVHQFQEMLRLNRSAGSDDDDDDDDDDDEEESESESESDE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19515-PA | 133 | GF19515-PA | 9..113 | 12..113 | 420 | 76.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19565-PA | 131 | GG19565-PA | 1..115 | 1..115 | 550 | 87.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24787-PA | 127 | GH24787-PA | 16..126 | 21..131 | 425 | 72.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Chrac-16-PB | 140 | CG15736-PB | 1..140 | 1..140 | 720 | 100 | Plus |
Chrac-16-PA | 140 | CG15736-PA | 1..140 | 1..140 | 720 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21483-PA | 131 | GI21483-PA | 9..130 | 10..140 | 474 | 71 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20264-PA | 135 | GL20264-PA | 1..117 | 1..117 | 454 | 72.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13924-PA | 135 | GA13924-PA | 1..117 | 1..117 | 454 | 72.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM13228-PA | 144 | GM13228-PA | 1..144 | 1..140 | 694 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15946-PA | 141 | GD15946-PA | 1..141 | 1..140 | 706 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18514-PA | 134 | GJ18514-PA | 10..134 | 11..135 | 450 | 74.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25044-PA | 149 | GK25044-PA | 2..119 | 6..115 | 412 | 68.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE16727-PA | 131 | GE16727-PA | 1..115 | 1..115 | 554 | 88.7 | Plus |