Clone RE59650 Report

Search the DGRC for RE59650

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:596
Well:50
Vector:pFlc-1
Associated Gene/TranscriptmRpS2-RA
Protein status:RE59650.pep: gold
Preliminary Size:753
Sequenced Size:940

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2937 2002-01-01 Sim4 clustering to Release 2
CG2937 2002-06-04 Blastp of sequenced clone
CG2937 2003-01-01 Sim4 clustering to Release 3
mRpS2 2008-04-29 Release 5.5 accounting
mRpS2 2008-08-15 Release 5.9 accounting
mRpS2 2008-12-18 5.12 accounting

Clone Sequence Records

RE59650.complete Sequence

940 bp (940 high quality bases) assembled on 2002-06-04

GenBank Submission: AY118630

> RE59650.complete
AAAAATCGACGGAAAAGAAGAAGAACATAGGTTATGAAAACACGAGCCGC
TCCAAAATGTTGAGAAAATCGTTTGCCAACCTACCCCGCTTTGGTCAGAT
GTGCGGTCTGCCACGACGCCTGCAGAGCACACAGCCGGAGCAATCGGTGG
AAACGGAACCGGAGGACATCGCCCTGGTGGAACAGCGGATTCTGAAGCAT
CCGGACTACTTCCAAGTGCACAACCTGTTCACCGTGCGCGACCTCTTCAA
TGCCCGAGTGCACTATGGCCACAAGGAGGGCTCCCTGGACGACCGAATGC
GTCCGTACTTGTTCGGCAGTCGATTAGGTCATCTGATCTTCGATCTGGAC
AAGACGGCATCACATCTGCGCGATGCCCTCAACTTTGCCGCACACATTGC
CTTCCGAGATGGCATCATTCTGTTCTTCAACCGCAACGCCATGAACTCAC
ATCTCGTGGAGCGAAAGGCCCAGGAGGCCGGTGAATTCTCGCACACTCGC
TTTTGGCGCGGCGGCATCTTTACCAATGCCAATGTGCAATTCGATGCGGT
CACCAGGCTGCCCGATCTTTGCATTTTCCTCAACACTCAAAACAACGTTA
TGGCTCAGCACACGGCGGTTCGGGACGCCGCCAAAATGGCCATACCAACC
ATTGGCATAGTGGACAGCAATTGCAATCCCAACCTGATCACCTATCCGGT
GCCCGGCAACGATGACTCGCCGGCCGCAGTGGAGCTCTATTGCAACCTCT
TCAAGGAAGCCATACTGCGTGGCAAGCGGGAACGACGCCAACTCCTTGGC
CTTCCGCCTCTGGACGAATCCCAGCCGCGGCGCAGTCGCAAAACTAAGTA
ATAGCCAAGTAGTAGTGTCAAGTTGATTTTGTTACATTTATCTTAATACA
AATGCCAATGGCCGTCAATCCACGAAAAAAAAAAAAAAAA

RE59650.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS2-RA 1123 mRpS2-RA 166..1089 2..925 4605 99.8 Plus
CG11927.a 1636 CG11927.a 1575..1636 925..864 310 100 Minus
CG11927-RA 1752 CG11927-RA 1691..1752 925..864 310 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4848556..4849398 924..82 4170 99.6 Minus
chr2L 23010047 chr2L 4849456..4849535 81..2 400 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:06:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4849438..4850281 925..82 4205 99.9 Minus
2L 23513712 2L 4850339..4850418 81..2 400 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:26:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4849438..4850281 925..82 4205 99.8 Minus
2L 23513712 2L 4850339..4850418 81..2 400 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:33:04 has no hits.

RE59650.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:33:57 Download gff for RE59650.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4848556..4849398 82..924 99 <- Minus
chr2L 4849456..4849535 1..81 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:27:26 Download gff for RE59650.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS2-RA 1..795 57..851 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:32:09 Download gff for RE59650.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS2-RA 1..795 57..851 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:04:54 Download gff for RE59650.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS2-RA 1..795 57..851 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:22:21 Download gff for RE59650.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS2-RA 1..795 57..851 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:41:54 Download gff for RE59650.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS2-RA 1..795 57..851 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:02:28 Download gff for RE59650.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS2-RA 1..923 2..924 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:32:09 Download gff for RE59650.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS2-RA 1..923 2..924 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:04:54 Download gff for RE59650.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS2-RA 2..924 2..924 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:22:21 Download gff for RE59650.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS2-RA 1..923 2..924 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:41:54 Download gff for RE59650.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS2-RA 2..924 2..924 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:57 Download gff for RE59650.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4849439..4850281 82..924 99 <- Minus
2L 4850339..4850418 1..81 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:57 Download gff for RE59650.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4849439..4850281 82..924 99 <- Minus
2L 4850339..4850418 1..81 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:57 Download gff for RE59650.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4849439..4850281 82..924 99 <- Minus
2L 4850339..4850418 1..81 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:04:54 Download gff for RE59650.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4849439..4850281 82..924 99 <- Minus
arm_2L 4850339..4850418 1..81 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:56:07 Download gff for RE59650.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4849439..4850281 82..924 99 <- Minus
2L 4850339..4850418 1..81 98   Minus

RE59650.hyp Sequence

Translation from 2 to 850

> RE59650.hyp
KSTEKKKNIGYENTSRSKMLRKSFANLPRFGQMCGLPRRLQSTQPEQSVE
TEPEDIALVEQRILKHPDYFQVHNLFTVRDLFNARVHYGHKEGSLDDRMR
PYLFGSRLGHLIFDLDKTASHLRDALNFAAHIAFRDGIILFFNRNAMNSH
LVERKAQEAGEFSHTRFWRGGIFTNANVQFDAVTRLPDLCIFLNTQNNVM
AQHTAVRDAAKMAIPTIGIVDSNCNPNLITYPVPGNDDSPAAVELYCNLF
KEAILRGKRERRQLLGLPPLDESQPRRSRKTK*

RE59650.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS2-PA 264 CG2937-PA 1..264 19..282 1389 100 Plus

RE59650.pep Sequence

Translation from 56 to 850

> RE59650.pep
MLRKSFANLPRFGQMCGLPRRLQSTQPEQSVETEPEDIALVEQRILKHPD
YFQVHNLFTVRDLFNARVHYGHKEGSLDDRMRPYLFGSRLGHLIFDLDKT
ASHLRDALNFAAHIAFRDGIILFFNRNAMNSHLVERKAQEAGEFSHTRFW
RGGIFTNANVQFDAVTRLPDLCIFLNTQNNVMAQHTAVRDAAKMAIPTIG
IVDSNCNPNLITYPVPGNDDSPAAVELYCNLFKEAILRGKRERRQLLGLP
PLDESQPRRSRKTK*

RE59650.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21552-PA 265 GF21552-PA 1..264 1..264 1344 94.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24347-PA 264 GG24347-PA 1..264 1..264 1382 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13663-PA 267 GH13663-PA 1..258 1..261 1191 84.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:12
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS2-PA 264 CG2937-PA 1..264 1..264 1389 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21009-PA 271 GI21009-PA 1..257 1..256 1216 87.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:06:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19496-PA 278 GL19496-PA 1..269 1..261 1285 87.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:06:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15531-PA 278 GA15531-PA 1..269 1..261 1285 87.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18067-PA 265 GM18067-PA 1..264 1..264 1410 99.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22685-PA 264 GD22685-PA 1..264 1..264 1415 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16130-PA 271 GJ16130-PA 1..262 1..261 1213 85.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24593-PA 275 GK24593-PA 1..275 1..264 1230 82.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:06:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14662-PA 264 GE14662-PA 1..264 1..264 1405 99.2 Plus