Clone RE59709 Report

Search the DGRC for RE59709

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:597
Well:9
Vector:pFlc-1
Associated Gene/TranscriptRpL32-RC
Protein status:RE59709.pep: gold
Sequenced Size:762

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7939 2004-01-14 Blastp of sequenced clone
RpL32 2008-04-29 Release 5.5 accounting
RpL32 2008-08-15 Release 5.9 accounting
RpL32 2008-12-18 5.12 accounting

Clone Sequence Records

RE59709.complete Sequence

762 bp (762 high quality bases) assembled on 2004-01-14

GenBank Submission: BT011442

> RE59709.complete
GCGGCAAGGTATGTGCGTGATTTTGGGCCCACGTGTATTTCCATTAATTT
TAAGCCGTAATTGTCGTTTTTGGCGGTTTCGAGTTGAACTGCGTTAGTCC
GTGCGCTGTTCGCAAGTGTGCGGCTCGTATTTCGACCGAATTCGGATCGA
TTCCTGTGAGAGTTCGCCAAATGGCTTCTGTTTGTGATGGGAATTCGTGG
GGCGACACACCGGCAACTCAATGGATACTGCCCAAGAAGCTAGCCCAACC
TGCTTCAAGATGACCATCCGCCCAGCATACAGGCCCAAGATCGTGAAGAA
GCGCACCAAGCACTTCATCCGCCACCAGTCGGATCGATATGCTAAGCTGT
CGCACAAATGGCGCAAGCCCAAGGGTATCGACAACAGAGTGCGTCGCCGC
TTCAAGGGACAGTATCTGATGCCCAACATCGGTTACGGATCGAACAAGCG
CACCCGCCACATGCTGCCCACCGGATTCAAGAAGTTCCTGGTGCACAACG
TGCGCGAGCTGGAGGTCCTGCTCATGCAGAACCGCGTTTACTGCGGCGAG
ATCGCCCACGGCGTCTCCTCCAAGAAGCGCAAGGAGATTGTCGAGCGCGC
CAAGCAGCTGTCGGTCCGCCTCACCAACCCCAACGGTCGCCTGCGTTCTC
AAGAGAACGAGTAAGCTTAAGATTCTTGAGAGTTCTTGTAACGTGGTCGG
AATACACATTTGTAAACGTTAATATACCGGACTTTTAGTTAAAAAACGAA
AAAAAAAAAAAA

RE59709.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
RpL32-RC 830 RpL32-RC 1..745 2..746 3710 99.8 Plus
RpL32.d 1032 RpL32.d 291..789 248..746 2480 99.7 Plus
RpL32-RD 774 RpL32-RD 291..774 248..731 2405 99.7 Plus
RpL32.d 1032 RpL32.d 17..267 2..252 1240 99.6 Plus
RpL32-RD 774 RpL32-RD 17..267 2..252 1240 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:48:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25867646..25868040 746..352 1975 100 Minus
chr3R 27901430 chr3R 25868305..25868555 252..2 1240 99.6 Minus
chr3R 27901430 chr3R 25868102..25868202 352..252 505 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:06:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30045231..30045625 746..352 1975 100 Minus
3R 32079331 3R 30045890..30046140 252..2 1240 99.6 Minus
3R 32079331 3R 30045687..30045787 352..252 505 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:53:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29786062..29786456 746..352 1975 100 Minus
3R 31820162 3R 29786721..29786971 252..2 1240 99.6 Minus
3R 31820162 3R 29786518..29786618 352..252 505 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:48:16 has no hits.

RE59709.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:49:08 Download gff for RE59709.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25868102..25868201 253..352 100 <- Minus
chr3R 25868305..25868555 1..252 99   Minus
chr3R 25867644..25868039 353..748 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:27:28 Download gff for RE59709.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 1..444 221..664 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:41:36 Download gff for RE59709.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 1..444 221..664 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:23:00 Download gff for RE59709.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 1..444 221..664 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:30:27 Download gff for RE59709.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 1..444 221..664 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:21:55 Download gff for RE59709.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 1..444 221..664 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:51:01 Download gff for RE59709.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 1..747 2..748 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:41:36 Download gff for RE59709.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 1..747 2..748 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:23:00 Download gff for RE59709.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 1..747 2..748 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:30:27 Download gff for RE59709.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 1..747 2..748 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:21:55 Download gff for RE59709.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 1..747 2..748 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:49:08 Download gff for RE59709.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30045229..30045624 353..748 99 <- Minus
3R 30045687..30045786 253..352 100 <- Minus
3R 30045890..30046140 1..252 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:49:08 Download gff for RE59709.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30045229..30045624 353..748 99 <- Minus
3R 30045687..30045786 253..352 100 <- Minus
3R 30045890..30046140 1..252 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:49:08 Download gff for RE59709.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30045229..30045624 353..748 99 <- Minus
3R 30045687..30045786 253..352 100 <- Minus
3R 30045890..30046140 1..252 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:00 Download gff for RE59709.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25871409..25871508 253..352 100 <- Minus
arm_3R 25871612..25871862 1..252 99   Minus
arm_3R 25870951..25871346 353..748 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:02:55 Download gff for RE59709.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29786060..29786455 353..748 99 <- Minus
3R 29786518..29786617 253..352 100 <- Minus
3R 29786721..29786971 1..252 99   Minus

RE59709.hyp Sequence

Translation from 220 to 663

> RE59709.hyp
MDTAQEASPTCFKMTIRPAYRPKIVKKRTKHFIRHQSDRYAKLSHKWRKP
KGIDNRVRRRFKGQYLMPNIGYGSNKRTRHMLPTGFKKFLVHNVRELEVL
LMQNRVYCGEIAHGVSSKKRKEIVERAKQLSVRLTNPNGRLRSQENE*

RE59709.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
RpL32-PC 147 CG7939-PC 1..147 1..147 775 100 Plus
RpL32-PD 134 CG7939-PD 1..134 14..147 705 100 Plus
RpL32-PA 134 CG7939-PA 1..134 14..147 705 100 Plus
RpL32-PB 134 CG7939-PB 1..134 14..147 705 100 Plus

RE59709.pep Sequence

Translation from 220 to 663

> RE59709.pep
MDTAQEASPTCFKMTIRPAYRPKIVKKRTKHFIRHQSDRYAKLSHKWRKP
KGIDNRVRRRFKGQYLMPNIGYGSNKRTRHMLPTGFKKFLVHNVRELEVL
LMQNRVYCGEIAHGVSSKKRKEIVERAKQLSVRLTNPNGRLRSQENE*

RE59709.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23239-PA 134 GF23239-PA 1..134 14..147 703 98.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11969-PA 134 GG11969-PA 1..134 14..147 707 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18400-PA 134 GH18400-PA 1..134 14..147 699 97.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
RpL32-PC 147 CG7939-PC 1..147 1..147 775 100 Plus
RpL32-PD 134 CG7939-PD 1..134 14..147 705 100 Plus
RpL32-PA 134 CG7939-PA 1..134 14..147 705 100 Plus
RpL32-PB 134 CG7939-PB 1..134 14..147 705 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23390-PA 134 GI23390-PA 1..134 14..147 707 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\RpL32-PA 134 GL13481-PA 1..134 14..147 698 97 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:42:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\RpL32-PB 134 GA20704-PB 1..134 14..147 700 97.8 Plus
Dpse\RpL32-PA 134 GA20704-PA 1..134 14..147 700 97.8 Plus
Dpse\GA27885-PA 87 GA27885-PA 1..87 14..147 375 61.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12186-PA 134 GM12186-PA 1..134 14..147 707 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\RpL32-PA 134 GD17388-PA 1..134 14..147 707 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\RpL32-PA 134 GJ10385-PA 1..134 14..147 707 100 Plus
Dvir\GJ22904-PA 124 GJ22904-PA 86..124 107..145 146 76.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\RpL32-PA 134 GK13422-PA 1..134 14..147 693 97.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:42:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL32-PA 134 GE23418-PA 1..134 14..147 707 100 Plus