BDGP Sequence Production Resources |
Search the DGRC for RE60105
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 601 |
Well: | 5 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG32109-RA |
Protein status: | RE60105.pep: gold |
Sequenced Size: | 1080 |
Gene | Date | Evidence |
---|---|---|
CG32109 | 2004-04-27 | Blastp of sequenced clone |
CG32109 | 2008-04-29 | Release 5.5 accounting |
CG32109 | 2008-08-15 | Release 5.9 accounting |
CG32109 | 2008-12-18 | 5.12 accounting |
1080 bp (1080 high quality bases) assembled on 2004-04-27
GenBank Submission: BT014644
> RE60105.complete ACACTGGTGCATAGCTTTTGTTTTTGTTGACTGAAATAAATAAAGAAATT GCAATATAATGGATCCAGTAGTACTTGTTTTATCTTATGGAGCAGTTCCT GCACTGGAAATAGTCGAAAATATTTTATCTGAAGTGAATCAATCGAAGGA ATCAACATCAACGGAGTGCTCACTTAATTGTTATAAGTGCATCATTAAAA CCAAGTACTATAACACTTCTATCAACTTAATTCCATTTTCTGGAAAACTG GAAGCTGTGCCGGAGAAAATTCTTCAAGCAACCGAGGCGTTGATTATTTA CTTTGATTCACAAGACACCTCCTTTATCGACACTATTCCCAAGACGTTAG CGAAGAATGAACAGATTCAGCTGGGCTTTCTGCTAACCTCTTCCACTTCA GAAGAAGGTGGATTGTCCTTTGGAGAAATTAAGGAGAAAACGAATTTCCT TTTTGACATCATAACATTGAGAAGCAATGTTGAGAGTGACCCAGATGAAG CTGAAAAGGACTACGAGGAAGTTGTGGAGGGTTTGAAAAACGTAGTTTGG TCCAATGTCAAGTTTGGTTCTGATCACAAGGAGGAAATCAGTGCCGACGA GCTGGATAGTCAGCTGAAGGACTTTGAAAACTTACTCCTCACGGCGCAAA ATCTACGTAACGATACGAGTCTCACTCGGGAACAATTTCTGGATCGGGCT GAGCAGTTTGCAGGCATAGTTTCCTCGATTTTAAATGACAATGATAGCGA CTAACTGATACTCAGTTATCGTAGGCAAACTAATCGTACTGTTTGTTATC AATAATAAATGTTAAGCTGATTCCACTGTAATGTGCTATATCTGGTCCGT ATTTTTGGTTTAGTTTTGAAGGTTTAAATACAAACAGGATTATGTTAAAT ATATTTGGTTTATTATTAAAAGCGGTACATATTTTTTGAAATAACAAGGT ATAAAACGTTGTTTATTTGCTAATGTATGCTTGAGAGCTTATGTATATTA AGGAATGAATAAATAAAGTGTGTGTTTGCTGTTAGCTTTCAATCATAAAA AAAAAAAAAAAAAAGAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 12736692..12737169 | 572..1049 | 2390 | 100 | Plus |
chr3L | 24539361 | chr3L | 12736377..12736632 | 317..572 | 1235 | 98.8 | Plus |
chr3L | 24539361 | chr3L | 12736125..12736321 | 120..316 | 985 | 100 | Plus |
chr3L | 24539361 | chr3L | 12735746..12735864 | 1..119 | 565 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 12746296..12746773 | 572..1049 | 2390 | 100 | Plus |
3L | 28110227 | 3L | 12745981..12746236 | 317..572 | 1280 | 100 | Plus |
3L | 28110227 | 3L | 12745729..12745925 | 120..316 | 985 | 100 | Plus |
3L | 28110227 | 3L | 12745350..12745468 | 1..119 | 595 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 12739396..12739873 | 572..1049 | 2390 | 100 | Plus |
3L | 28103327 | 3L | 12739081..12739336 | 317..572 | 1280 | 100 | Plus |
3L | 28103327 | 3L | 12738829..12739025 | 120..316 | 985 | 100 | Plus |
3L | 28103327 | 3L | 12738450..12738568 | 1..119 | 595 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Max-element | 8556 | Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). | 1467..1527 | 4..64 | 116 | 65.6 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 12736125..12736321 | 120..316 | 100 | -> | Plus |
chr3L | 12736377..12736632 | 317..572 | 98 | -> | Plus |
chr3L | 12735746..12735864 | 1..119 | 98 | -> | Plus |
chr3L | 12736693..12737166 | 573..1046 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32109-RA | 1..696 | 59..754 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32109-RA | 1..696 | 59..754 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32109-RA | 1..696 | 59..754 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32109-RA | 1..696 | 59..754 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32109-RA | 1..696 | 59..754 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32109-RA | 1..754 | 1..754 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32109-RA | 1..1046 | 1..1046 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32109-RA | 7..1052 | 1..1046 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32109-RA | 1..754 | 1..754 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32109-RA | 7..1052 | 1..1046 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 12745350..12745468 | 1..119 | 100 | -> | Plus |
3L | 12745729..12745925 | 120..316 | 100 | -> | Plus |
3L | 12745981..12746236 | 317..572 | 100 | -> | Plus |
3L | 12746297..12746770 | 573..1046 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 12745350..12745468 | 1..119 | 100 | -> | Plus |
3L | 12745729..12745925 | 120..316 | 100 | -> | Plus |
3L | 12745981..12746236 | 317..572 | 100 | -> | Plus |
3L | 12746297..12746770 | 573..1046 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 12745350..12745468 | 1..119 | 100 | -> | Plus |
3L | 12745729..12745925 | 120..316 | 100 | -> | Plus |
3L | 12745981..12746236 | 317..572 | 100 | -> | Plus |
3L | 12746297..12746770 | 573..1046 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 12738450..12738568 | 1..119 | 100 | -> | Plus |
arm_3L | 12738829..12739025 | 120..316 | 100 | -> | Plus |
arm_3L | 12739081..12739336 | 317..572 | 100 | -> | Plus |
arm_3L | 12739397..12739870 | 573..1046 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 12739081..12739336 | 317..572 | 100 | -> | Plus |
3L | 12739397..12739870 | 573..1046 | 100 | Plus | |
3L | 12738450..12738568 | 1..119 | 100 | -> | Plus |
3L | 12738829..12739025 | 120..316 | 100 | -> | Plus |
Translation from 58 to 753
> RE60105.hyp MDPVVLVLSYGAVPALEIVENILSEVNQSKESTSTECSLNCYKCIIKTKY YNTSINLIPFSGKLEAVPEKILQATEALIIYFDSQDTSFIDTIPKTLAKN EQIQLGFLLTSSTSEEGGLSFGEIKEKTNFLFDIITLRSNVESDPDEAEK DYEEVVEGLKNVVWSNVKFGSDHKEEISADELDSQLKDFENLLLTAQNLR NDTSLTREQFLDRAEQFAGIVSSILNDNDSD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32109-PA | 231 | CG32109-PA | 1..231 | 1..231 | 1159 | 100 | Plus |
Translation from 58 to 753
> RE60105.pep MDPVVLVLSYGAVPALEIVENILSEVNQSKESTSTECSLNCYKCIIKTKY YNTSINLIPFSGKLEAVPEKILQATEALIIYFDSQDTSFIDTIPKTLAKN EQIQLGFLLTSSTSEEGGLSFGEIKEKTNFLFDIITLRSNVESDPDEAEK DYEEVVEGLKNVVWSNVKFGSDHKEEISADELDSQLKDFENLLLTAQNLR NDTSLTREQFLDRAEQFAGIVSSILNDNDSD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23567-PA | 233 | GF23567-PA | 1..233 | 1..231 | 831 | 73 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15593-PA | 231 | GG15593-PA | 1..231 | 1..231 | 1132 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16832-PA | 245 | GH16832-PA | 1..245 | 1..231 | 530 | 49.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32109-PA | 231 | CG32109-PA | 1..231 | 1..231 | 1159 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11925-PA | 240 | GI11925-PA | 1..240 | 1..231 | 573 | 50.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25207-PA | 242 | GL25207-PA | 1..242 | 1..231 | 634 | 52.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16687-PA | 242 | GA16687-PA | 1..242 | 1..231 | 630 | 52.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25368-PA | 231 | GM25368-PA | 1..231 | 1..231 | 1163 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14400-PA | 231 | GD14400-PA | 1..231 | 1..231 | 1154 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13800-PA | 243 | GJ13800-PA | 1..243 | 1..231 | 543 | 48.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20271-PA | 240 | GK20271-PA | 1..240 | 1..231 | 613 | 53.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21920-PA | 231 | GE21920-PA | 1..231 | 1..231 | 1138 | 95.2 | Plus |