Clone RE60105 Report

Search the DGRC for RE60105

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:601
Well:5
Vector:pFlc-1
Associated Gene/TranscriptCG32109-RA
Protein status:RE60105.pep: gold
Sequenced Size:1080

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32109 2004-04-27 Blastp of sequenced clone
CG32109 2008-04-29 Release 5.5 accounting
CG32109 2008-08-15 Release 5.9 accounting
CG32109 2008-12-18 5.12 accounting

Clone Sequence Records

RE60105.complete Sequence

1080 bp (1080 high quality bases) assembled on 2004-04-27

GenBank Submission: BT014644

> RE60105.complete
ACACTGGTGCATAGCTTTTGTTTTTGTTGACTGAAATAAATAAAGAAATT
GCAATATAATGGATCCAGTAGTACTTGTTTTATCTTATGGAGCAGTTCCT
GCACTGGAAATAGTCGAAAATATTTTATCTGAAGTGAATCAATCGAAGGA
ATCAACATCAACGGAGTGCTCACTTAATTGTTATAAGTGCATCATTAAAA
CCAAGTACTATAACACTTCTATCAACTTAATTCCATTTTCTGGAAAACTG
GAAGCTGTGCCGGAGAAAATTCTTCAAGCAACCGAGGCGTTGATTATTTA
CTTTGATTCACAAGACACCTCCTTTATCGACACTATTCCCAAGACGTTAG
CGAAGAATGAACAGATTCAGCTGGGCTTTCTGCTAACCTCTTCCACTTCA
GAAGAAGGTGGATTGTCCTTTGGAGAAATTAAGGAGAAAACGAATTTCCT
TTTTGACATCATAACATTGAGAAGCAATGTTGAGAGTGACCCAGATGAAG
CTGAAAAGGACTACGAGGAAGTTGTGGAGGGTTTGAAAAACGTAGTTTGG
TCCAATGTCAAGTTTGGTTCTGATCACAAGGAGGAAATCAGTGCCGACGA
GCTGGATAGTCAGCTGAAGGACTTTGAAAACTTACTCCTCACGGCGCAAA
ATCTACGTAACGATACGAGTCTCACTCGGGAACAATTTCTGGATCGGGCT
GAGCAGTTTGCAGGCATAGTTTCCTCGATTTTAAATGACAATGATAGCGA
CTAACTGATACTCAGTTATCGTAGGCAAACTAATCGTACTGTTTGTTATC
AATAATAAATGTTAAGCTGATTCCACTGTAATGTGCTATATCTGGTCCGT
ATTTTTGGTTTAGTTTTGAAGGTTTAAATACAAACAGGATTATGTTAAAT
ATATTTGGTTTATTATTAAAAGCGGTACATATTTTTTGAAATAACAAGGT
ATAAAACGTTGTTTATTTGCTAATGTATGCTTGAGAGCTTATGTATATTA
AGGAATGAATAAATAAAGTGTGTGTTTGCTGTTAGCTTTCAATCATAAAA
AAAAAAAAAAAAAAGAAAAAAAAAAAAAAA

RE60105.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:01:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG32109-RA 1072 CG32109-RA 27..1072 1..1046 5230 100 Plus
Klc.c 1798 Klc.c 1638..1798 1049..889 805 100 Minus
Klc.b 1821 Klc.b 1661..1821 1049..889 805 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:50:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12736692..12737169 572..1049 2390 100 Plus
chr3L 24539361 chr3L 12736377..12736632 317..572 1235 98.8 Plus
chr3L 24539361 chr3L 12736125..12736321 120..316 985 100 Plus
chr3L 24539361 chr3L 12735746..12735864 1..119 565 98.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:07:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12746296..12746773 572..1049 2390 100 Plus
3L 28110227 3L 12745981..12746236 317..572 1280 100 Plus
3L 28110227 3L 12745729..12745925 120..316 985 100 Plus
3L 28110227 3L 12745350..12745468 1..119 595 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12739396..12739873 572..1049 2390 100 Plus
3L 28103327 3L 12739081..12739336 317..572 1280 100 Plus
3L 28103327 3L 12738829..12739025 120..316 985 100 Plus
3L 28103327 3L 12738450..12738568 1..119 595 100 Plus
Blast to na_te.dros performed 2019-03-15 22:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1467..1527 4..64 116 65.6 Plus

RE60105.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:51:47 Download gff for RE60105.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12736125..12736321 120..316 100 -> Plus
chr3L 12736377..12736632 317..572 98 -> Plus
chr3L 12735746..12735864 1..119 98 -> Plus
chr3L 12736693..12737166 573..1046 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:27:45 Download gff for RE60105.complete
Subject Subject Range Query Range Percent Splice Strand
CG32109-RA 1..696 59..754 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:36:32 Download gff for RE60105.complete
Subject Subject Range Query Range Percent Splice Strand
CG32109-RA 1..696 59..754 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:33:17 Download gff for RE60105.complete
Subject Subject Range Query Range Percent Splice Strand
CG32109-RA 1..696 59..754 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:20:22 Download gff for RE60105.complete
Subject Subject Range Query Range Percent Splice Strand
CG32109-RA 1..696 59..754 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:35:42 Download gff for RE60105.complete
Subject Subject Range Query Range Percent Splice Strand
CG32109-RA 1..696 59..754 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:43:46 Download gff for RE60105.complete
Subject Subject Range Query Range Percent Splice Strand
CG32109-RA 1..754 1..754 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:36:32 Download gff for RE60105.complete
Subject Subject Range Query Range Percent Splice Strand
CG32109-RA 1..1046 1..1046 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:33:17 Download gff for RE60105.complete
Subject Subject Range Query Range Percent Splice Strand
CG32109-RA 7..1052 1..1046 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:20:22 Download gff for RE60105.complete
Subject Subject Range Query Range Percent Splice Strand
CG32109-RA 1..754 1..754 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:35:42 Download gff for RE60105.complete
Subject Subject Range Query Range Percent Splice Strand
CG32109-RA 7..1052 1..1046 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:51:47 Download gff for RE60105.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12745350..12745468 1..119 100 -> Plus
3L 12745729..12745925 120..316 100 -> Plus
3L 12745981..12746236 317..572 100 -> Plus
3L 12746297..12746770 573..1046 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:51:47 Download gff for RE60105.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12745350..12745468 1..119 100 -> Plus
3L 12745729..12745925 120..316 100 -> Plus
3L 12745981..12746236 317..572 100 -> Plus
3L 12746297..12746770 573..1046 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:51:47 Download gff for RE60105.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12745350..12745468 1..119 100 -> Plus
3L 12745729..12745925 120..316 100 -> Plus
3L 12745981..12746236 317..572 100 -> Plus
3L 12746297..12746770 573..1046 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:33:17 Download gff for RE60105.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12738450..12738568 1..119 100 -> Plus
arm_3L 12738829..12739025 120..316 100 -> Plus
arm_3L 12739081..12739336 317..572 100 -> Plus
arm_3L 12739397..12739870 573..1046 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:57:40 Download gff for RE60105.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12739081..12739336 317..572 100 -> Plus
3L 12739397..12739870 573..1046 100   Plus
3L 12738450..12738568 1..119 100 -> Plus
3L 12738829..12739025 120..316 100 -> Plus

RE60105.hyp Sequence

Translation from 58 to 753

> RE60105.hyp
MDPVVLVLSYGAVPALEIVENILSEVNQSKESTSTECSLNCYKCIIKTKY
YNTSINLIPFSGKLEAVPEKILQATEALIIYFDSQDTSFIDTIPKTLAKN
EQIQLGFLLTSSTSEEGGLSFGEIKEKTNFLFDIITLRSNVESDPDEAEK
DYEEVVEGLKNVVWSNVKFGSDHKEEISADELDSQLKDFENLLLTAQNLR
NDTSLTREQFLDRAEQFAGIVSSILNDNDSD*

RE60105.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG32109-PA 231 CG32109-PA 1..231 1..231 1159 100 Plus

RE60105.pep Sequence

Translation from 58 to 753

> RE60105.pep
MDPVVLVLSYGAVPALEIVENILSEVNQSKESTSTECSLNCYKCIIKTKY
YNTSINLIPFSGKLEAVPEKILQATEALIIYFDSQDTSFIDTIPKTLAKN
EQIQLGFLLTSSTSEEGGLSFGEIKEKTNFLFDIITLRSNVESDPDEAEK
DYEEVVEGLKNVVWSNVKFGSDHKEEISADELDSQLKDFENLLLTAQNLR
NDTSLTREQFLDRAEQFAGIVSSILNDNDSD*

RE60105.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23567-PA 233 GF23567-PA 1..233 1..231 831 73 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15593-PA 231 GG15593-PA 1..231 1..231 1132 94.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16832-PA 245 GH16832-PA 1..245 1..231 530 49.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG32109-PA 231 CG32109-PA 1..231 1..231 1159 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11925-PA 240 GI11925-PA 1..240 1..231 573 50.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25207-PA 242 GL25207-PA 1..242 1..231 634 52.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16687-PA 242 GA16687-PA 1..242 1..231 630 52.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25368-PA 231 GM25368-PA 1..231 1..231 1163 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14400-PA 231 GD14400-PA 1..231 1..231 1154 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13800-PA 243 GJ13800-PA 1..243 1..231 543 48.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20271-PA 240 GK20271-PA 1..240 1..231 613 53.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21920-PA 231 GE21920-PA 1..231 1..231 1138 95.2 Plus