Clone RE60135 Report

Search the DGRC for RE60135

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:601
Well:35
Vector:pFlc-1
Associated Gene/TranscriptCG6610-RA
Protein status:RE60135.pep: Imported from assembly
Preliminary Size:276
Sequenced Size:415

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6610 2002-01-01 Sim4 clustering to Release 2
CG6610 2002-04-26 Blastp of sequenced clone
CG6610 2003-01-01 Sim4 clustering to Release 3
CG6610 2008-04-29 Release 5.5 accounting
CG6610 2008-08-15 Release 5.9 accounting
CG6610 2008-12-18 5.12 accounting

Clone Sequence Records

RE60135.complete Sequence

415 bp (415 high quality bases) assembled on 2019-12-18

GenBank Submission: AY113521

> RE60135.complete
ATTGTTTACCTCGCTGCTAAAAAGTTTTTAGCGCAATTCCAATTATTATT
GTTAATAATAGTAAACAAATCATACGACAACATGACTGCCGTTCCACCCC
CCTCCAACATCTCTACCCTAATGCCATTGGAATTGGTGGACAAATGCATC
GGTTCCCGCATCCACATTATCATGAAGAACGACAAGGAGATGGTGGGAAC
TCTCTTAGGATTCGATGACTTTGTGAATATGCTCTTGGACGACGTAACGG
AGTATGAAAATACCCCCGACGGCCGCCGCATCACCAAACTGGATCAGATT
CTGCTCAACGGGAACAATATCACAATGTTGGTGCCTGGCGGAGAGCTGGC
GGAGTAGCAAGGTTCCATTTGTAAACATAAATACATTTGTAAAATATCGA
AAAAAAAAAAAAAAA

RE60135.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG6610-RA 746 CG6610-RA 64..465 1..402 1995 99.7 Plus
CG6610.a 630 CG6610.a 64..469 1..402 1930 98.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-12-18 14:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6068415..6068616 130..331 995 99.5 Plus
chr3L 24539361 chr3L 6068214..6068343 1..130 650 100 Plus
chr3L 24539361 chr3L 6068677..6068748 327..398 360 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:07:09 has no hits.
Blast to dmel-all-transcript-r6.23.fasta performed 2019-12-18 14:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG6610-RC 520 CG6610-RC 24..421 1..398 1990 100 Plus
CG6610-RB 421 CG6610-RB 24..421 1..398 1990 100 Plus
CG6610-RA 586 CG6610-RA 24..421 1..398 1990 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-12-18 14:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6075760..6075961 130..331 995 99.5 Plus
3L 28110227 3L 6075559..6075688 1..130 650 100 Plus
3L 28110227 3L 6076022..6076097 327..402 365 98.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6068860..6069061 130..331 995 99.5 Plus
3L 28103327 3L 6068659..6068788 1..130 650 100 Plus
3L 28103327 3L 6069122..6069197 327..402 365 98.6 Plus
Blast to na_te.dros performed on 2019-12-18 14:09:42 has no hits.

RE60135.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-12-18 14:09:43 Download gff for RE60135.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6068214..6068343 1..130 100 -> Plus
chr3L 6068416..6068612 131..327 100 -> Plus
chr3L 6068678..6068748 328..399 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:27:46 Download gff for RE60135.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 1..276 82..357 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:14 Download gff for RE60135.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 1..276 82..357 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:22:13 Download gff for RE60135.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 1..276 82..357 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:40 Download gff for RE60135.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 1..276 82..357 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:21:31 Download gff for RE60135.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 1..276 82..357 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:05:20 Download gff for RE60135.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 23..420 1..399 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:14 Download gff for RE60135.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 23..420 1..399 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:22:13 Download gff for RE60135.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 24..421 1..399 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:40 Download gff for RE60135.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 23..420 1..399 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:21:31 Download gff for RE60135.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 24..421 1..399 99   Plus
Sim4 to dmel-all-transcript-r6.23.fasta performed 2019-12-18 14:09:43 Download gff for RE60135.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RC 24..421 1..399 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-12-18 14:09:43 Download gff for RE60135.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6075761..6075957 131..327 100 -> Plus
3L 6076023..6076093 328..399 98   Plus
3L 6075559..6075688 1..130 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-12-18 14:09:43 Download gff for RE60135.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6075761..6075957 131..327 100 -> Plus
3L 6076023..6076093 328..399 98   Plus
3L 6075559..6075688 1..130 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:22:13 Download gff for RE60135.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6069123..6069193 328..399 98   Plus
arm_3L 6068659..6068788 1..130 100 -> Plus
arm_3L 6068861..6069057 131..327 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:18:11 Download gff for RE60135.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6068659..6068788 1..130 100 -> Plus
3L 6068861..6069057 131..327 100 -> Plus
3L 6069123..6069193 328..399 98   Plus

RE60135.pep Sequence

Translation from 0 to 356

> RE60135.pep
IVYLAAKKFLAQFQLLLLIIVNKSYDNMTAVPPPSNISTLMPLELVDKCI
GSRIHIIMKNDKEMVGTLLGFDDFVNMLLDDVTEYENTPDGRRITKLDQI
LLNGNNITMLVPGGELAE*

RE60135.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-12-18 14:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23512-PA 91 GF23512-PA 1..91 28..118 465 97.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-12-18 14:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15317-PA 91 GG15317-PA 1..91 28..118 471 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-12-18 14:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15826-PA 91 GH15826-PA 1..91 28..118 468 98.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-12-18 14:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG6610-PC 91 CG6610-PC 1..91 28..118 469 100 Plus
CG6610-PB 91 CG6610-PB 1..91 28..118 469 100 Plus
CG6610-PA 91 CG6610-PA 1..91 28..118 469 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-12-18 14:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12608-PA 91 GI12608-PA 1..91 28..118 468 98.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-12-18 14:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15546-PA 91 GL15546-PA 1..91 28..118 465 97.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-12-18 14:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19721-PA 91 GA19721-PA 1..91 28..118 465 97.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-12-18 14:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14749-PA 91 GM14749-PA 1..91 28..118 471 100 Plus
Dsec\GM26694-PA 61 GM26694-PA 1..61 58..118 311 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-12-18 14:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13931-PA 91 GD13931-PA 1..91 28..118 471 100 Plus
Dsim\GD13932-PA 55 GD13932-PA 1..55 64..118 279 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-12-18 14:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12731-PA 91 GJ12731-PA 1..91 28..118 468 98.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-12-18 14:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17260-PA 91 GK17260-PA 1..91 28..118 463 96.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-12-18 14:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21536-PA 91 GE21536-PA 1..91 28..118 471 100 Plus

RE60135.hyp Sequence

Translation from 0 to 356

> RE60135.hyp
IVYLAAKKFLAQFQLLLLIIVNKSYDNMTAVPPPSNISTLMPLELVDKCI
GSRIHIIMKNDKEMVGTLLGFDDFVNMLLDDVTEYENTPDGRRITKLDQI
LLNGNNITMLVPGGELAE*

RE60135.hyp Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-12-18 14:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG6610-PC 91 CG6610-PC 1..91 28..118 469 100 Plus
CG6610-PB 91 CG6610-PB 1..91 28..118 469 100 Plus
CG6610-PA 91 CG6610-PA 1..91 28..118 469 100 Plus