BDGP Sequence Production Resources |
Search the DGRC for RE60135
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 601 |
Well: | 35 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG6610-RA |
Protein status: | RE60135.pep: Imported from assembly |
Preliminary Size: | 276 |
Sequenced Size: | 415 |
Gene | Date | Evidence |
---|---|---|
CG6610 | 2002-01-01 | Sim4 clustering to Release 2 |
CG6610 | 2002-04-26 | Blastp of sequenced clone |
CG6610 | 2003-01-01 | Sim4 clustering to Release 3 |
CG6610 | 2008-04-29 | Release 5.5 accounting |
CG6610 | 2008-08-15 | Release 5.9 accounting |
CG6610 | 2008-12-18 | 5.12 accounting |
415 bp (415 high quality bases) assembled on 2019-12-18
GenBank Submission: AY113521
> RE60135.complete ATTGTTTACCTCGCTGCTAAAAAGTTTTTAGCGCAATTCCAATTATTATT GTTAATAATAGTAAACAAATCATACGACAACATGACTGCCGTTCCACCCC CCTCCAACATCTCTACCCTAATGCCATTGGAATTGGTGGACAAATGCATC GGTTCCCGCATCCACATTATCATGAAGAACGACAAGGAGATGGTGGGAAC TCTCTTAGGATTCGATGACTTTGTGAATATGCTCTTGGACGACGTAACGG AGTATGAAAATACCCCCGACGGCCGCCGCATCACCAAACTGGATCAGATT CTGCTCAACGGGAACAATATCACAATGTTGGTGCCTGGCGGAGAGCTGGC GGAGTAGCAAGGTTCCATTTGTAAACATAAATACATTTGTAAAATATCGA AAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 6068415..6068616 | 130..331 | 995 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 6068214..6068343 | 1..130 | 650 | 100 | Plus |
chr3L | 24539361 | chr3L | 6068677..6068748 | 327..398 | 360 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6610-RC | 520 | CG6610-RC | 24..421 | 1..398 | 1990 | 100 | Plus |
CG6610-RB | 421 | CG6610-RB | 24..421 | 1..398 | 1990 | 100 | Plus |
CG6610-RA | 586 | CG6610-RA | 24..421 | 1..398 | 1990 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 6068214..6068343 | 1..130 | 100 | -> | Plus |
chr3L | 6068416..6068612 | 131..327 | 100 | -> | Plus |
chr3L | 6068678..6068748 | 328..399 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6610-RA | 1..276 | 82..357 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6610-RA | 1..276 | 82..357 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6610-RA | 1..276 | 82..357 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6610-RA | 1..276 | 82..357 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6610-RA | 1..276 | 82..357 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6610-RA | 23..420 | 1..399 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6610-RA | 23..420 | 1..399 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6610-RA | 24..421 | 1..399 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6610-RA | 23..420 | 1..399 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6610-RA | 24..421 | 1..399 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6610-RC | 24..421 | 1..399 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 6075761..6075957 | 131..327 | 100 | -> | Plus |
3L | 6076023..6076093 | 328..399 | 98 | Plus | |
3L | 6075559..6075688 | 1..130 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 6075761..6075957 | 131..327 | 100 | -> | Plus |
3L | 6076023..6076093 | 328..399 | 98 | Plus | |
3L | 6075559..6075688 | 1..130 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 6069123..6069193 | 328..399 | 98 | Plus | |
arm_3L | 6068659..6068788 | 1..130 | 100 | -> | Plus |
arm_3L | 6068861..6069057 | 131..327 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 6068659..6068788 | 1..130 | 100 | -> | Plus |
3L | 6068861..6069057 | 131..327 | 100 | -> | Plus |
3L | 6069123..6069193 | 328..399 | 98 | Plus |
Translation from 0 to 356
> RE60135.pep IVYLAAKKFLAQFQLLLLIIVNKSYDNMTAVPPPSNISTLMPLELVDKCI GSRIHIIMKNDKEMVGTLLGFDDFVNMLLDDVTEYENTPDGRRITKLDQI LLNGNNITMLVPGGELAE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23512-PA | 91 | GF23512-PA | 1..91 | 28..118 | 465 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15317-PA | 91 | GG15317-PA | 1..91 | 28..118 | 471 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15826-PA | 91 | GH15826-PA | 1..91 | 28..118 | 468 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6610-PC | 91 | CG6610-PC | 1..91 | 28..118 | 469 | 100 | Plus |
CG6610-PB | 91 | CG6610-PB | 1..91 | 28..118 | 469 | 100 | Plus |
CG6610-PA | 91 | CG6610-PA | 1..91 | 28..118 | 469 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12608-PA | 91 | GI12608-PA | 1..91 | 28..118 | 468 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15546-PA | 91 | GL15546-PA | 1..91 | 28..118 | 465 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19721-PA | 91 | GA19721-PA | 1..91 | 28..118 | 465 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14749-PA | 91 | GM14749-PA | 1..91 | 28..118 | 471 | 100 | Plus |
Dsec\GM26694-PA | 61 | GM26694-PA | 1..61 | 58..118 | 311 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13931-PA | 91 | GD13931-PA | 1..91 | 28..118 | 471 | 100 | Plus |
Dsim\GD13932-PA | 55 | GD13932-PA | 1..55 | 64..118 | 279 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12731-PA | 91 | GJ12731-PA | 1..91 | 28..118 | 468 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17260-PA | 91 | GK17260-PA | 1..91 | 28..118 | 463 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21536-PA | 91 | GE21536-PA | 1..91 | 28..118 | 471 | 100 | Plus |
Translation from 0 to 356
> RE60135.hyp IVYLAAKKFLAQFQLLLLIIVNKSYDNMTAVPPPSNISTLMPLELVDKCI GSRIHIIMKNDKEMVGTLLGFDDFVNMLLDDVTEYENTPDGRRITKLDQI LLNGNNITMLVPGGELAE*