Clone RE60324 Report

Search the DGRC for RE60324

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:603
Well:24
Vector:pFlc-1
Associated Gene/TranscriptDrip-RA
Protein status:RE60324.pep: gold
Sequenced Size:1784

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9023 2003-01-01 Sim4 clustering to Release 3
Drip 2008-04-29 Release 5.5 accounting
Drip 2008-08-15 Release 5.9 accounting
Drip 2008-12-18 5.12 accounting

Clone Sequence Records

RE60324.complete Sequence

1784 bp (1784 high quality bases) assembled on 2005-10-06

GenBank Submission: BT023883

> RE60324.complete
GTTGTTTGCGCTCGAGCAGCGAACGTGGTAGCACAGCTTTAAGCACTACA
GCACTACAGTACAAACTGCGAGAAAGAAAAGCGGCAGTTTCGAAAATCCG
AAAAGGAAATCGAGTTCGGAGCGGTTAGTTTAATTGGCGATAATAATAAA
CTAATAATAAAATCGAGTTATTGCACGTTGCGCTTTCCAATTTCGAAAAG
GAAATCTGAAAATATTGTAGCCCAGTGAAGAAAATAAGTCAATCGGGTGA
AATTAAATTGATAACAACACCGCTTTCCGCCCCATATTCGACTCCGTGTG
GTCAAGTGGCAGACAATTGTGCAACCTCAAGACTCTTAACCTTAACAATT
ATATTTCGGCCACAAAAAACTATTGGCACAATTCAGTTCGATTCGAGTGC
GCGCTAACTCACTTTTACCCGCAGCAAAAAGCAATAAGGCAAAAAGCACG
CTTTGAAAACGAAAGCAAAGCACAAGTTCGCTTCGAAACCCCCCACGCTT
GCCAAAAATCTCAAGTGGCAGCCCCCAGAAGACAGTAGATCGTAGCCAGA
AGACCGAAGACAGAAGACAGCAAAATGGTCGAGAAAACAGAAATGTCGAA
ATTCGTTGGCGTTGCCGACATAACCGAGAACAAGAAAATCTGGCGCATGC
TGCTCGGCGAACTGGTGGGCACATTTTTCTTGATCTTCGTCGGCGTTGGC
AGCACGACGAGCGGAAGTGTACCACAAATCGCATTCACCTTTGGCTTGAC
GGTGGCCACCATCGCCCAGGGCTTGGGCCACCTCAGTGGCTGTCACATTA
ATCCGGCGGTCACCCTTGGATTCCTGATCGTTGGTGAGATCAGCATTCTG
AAGGCTGCCTTCTACATCATCGTCCAATGCGTGGGCGCCATTGCTGGAGC
GGCTGTGATAAAGGTGGCACTCGATGGAGTGGCTGGTGGCGACCTGGGAG
TATCCTCCTTTGATCCCTCCCTGAACTGTGCACAGGCGGTGCTGATCGAA
GCGCTGATCACCTTTATTTTGGTTTTCGTGGTCAAGGCTGTTTCGGATCC
TGGACGCCAGGATATCAAGGGATCAGCGCCACTGGCTGTTGGTTTGGCCA
TCGCCGCTGGCCATTTGTGTGCAATCAAACTGAGCGGTGCCAGCATGAAT
CCCGCCCGGTCCTTTGGTCCCGCCGTAGTGCAGGGCGTCTGGACCTATCA
CTGGGTTTACTGGGTGGGTCCCATTGCCGGCGGCCTGTTGGCCGGAATCA
TCTACAGATTAATCTTCAAGGTACGCAAGGGCGATGATGAGACCGACTCG
TACGACTTCTAAACAGTGGCCGAATACCATATATGTATTTTTGTAAATGT
CCGCACCTGCTTTCCATTCCCATCACACATTCGCTTTCCCATCGAATTCG
TTTGCCGAAATTTCTCGTAGTTTAGGTTTGCTCCACCATCACAACCAAGC
TGAATTTTCAACGCAATTTGTACCATTTTATTTTTTAAACAATAAGAAAG
CAAATGTCTCGTTTAGTTGTACCGCGATGCCCCAGCACTTTAAAATATGC
AATATTGTATTTGAGTAATTTTAAGCTAAATTATATGCACATCATCATTA
CGCGAATCGAAGGAAAACTGTATTGAAGCTTAACTAAATTGTACTGGGAA
ATCACTTTCCAAAGCAGCGAACAGGTGGATTACCTACGCTGTTGATCGCC
ACTTGCTGAGCACCTGCGAATTGTATTATGACTATGTGTAATAAAAAAAT
ATAAAGAAATTACCAAAGAAAAAAAAAAAAAAAA

RE60324.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Drip.d 2141 Drip.d 279..2040 5..1766 8810 100 Plus
Drip-RA 1885 Drip-RA 23..1784 5..1766 8810 100 Plus
Drip-RB 1480 Drip-RB 119..1461 424..1766 6715 100 Plus
Drip-RB 1480 Drip-RB 1..119 5..123 595 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7299414..7300072 1766..1124 2985 97.6 Minus
chr2R 21145070 chr2R 7316553..7317138 590..5 2930 100 Minus
chr2R 21145070 chr2R 7300130..7300486 1123..767 1770 99.7 Minus
chr2R 21145070 chr2R 7308755..7308937 770..588 915 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:07:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11411932..11412574 1766..1124 3215 100 Minus
2R 25286936 2R 11429053..11429638 590..5 2930 100 Minus
2R 25286936 2R 11412632..11412988 1123..767 1785 100 Minus
2R 25286936 2R 11421257..11421439 770..588 915 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11413131..11413773 1766..1124 3215 100 Minus
2R 25260384 2R 11430252..11430837 590..5 2930 100 Minus
2R 25260384 2R 11413831..11414187 1123..767 1785 100 Minus
2R 25260384 2R 11422456..11422638 770..588 915 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:28:47 has no hits.

RE60324.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:29:45 Download gff for RE60324.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7299412..7300072 1124..1768 97 <- Minus
chr2R 7300130..7300483 770..1123 99 <- Minus
chr2R 7308756..7308934 591..769 100 <- Minus
chr2R 7316553..7317141 1..590 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:43:18 Download gff for RE60324.complete
Subject Subject Range Query Range Percent Splice Strand
Drip-RB 1..738 575..1312 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:49:18 Download gff for RE60324.complete
Subject Subject Range Query Range Percent Splice Strand
Drip-RB 1..738 575..1312 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:29:32 Download gff for RE60324.complete
Subject Subject Range Query Range Percent Splice Strand
Drip-RA 1..738 575..1312 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:30:12 Download gff for RE60324.complete
Subject Subject Range Query Range Percent Splice Strand
Drip-RB 1..738 575..1312 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:33:17 Download gff for RE60324.complete
Subject Subject Range Query Range Percent Splice Strand
Drip-RA 1..738 575..1312 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:43:17 Download gff for RE60324.complete
Subject Subject Range Query Range Percent Splice Strand
Drip-RA 1..1755 2..1756 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:49:18 Download gff for RE60324.complete
Subject Subject Range Query Range Percent Splice Strand
Drip-RA 1..1755 2..1756 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:29:32 Download gff for RE60324.complete
Subject Subject Range Query Range Percent Splice Strand
Drip-RA 3..1745 1..1742 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:30:12 Download gff for RE60324.complete
Subject Subject Range Query Range Percent Splice Strand
Drip-RA 1..1755 2..1756 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:33:17 Download gff for RE60324.complete
Subject Subject Range Query Range Percent Splice Strand
Drip-RA 3..1745 1..1742 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:45 Download gff for RE60324.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11411930..11412574 1124..1768 99 <- Minus
2R 11412632..11412985 770..1123 100 <- Minus
2R 11421258..11421436 591..769 100 <- Minus
2R 11429053..11429641 1..590 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:45 Download gff for RE60324.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11411930..11412574 1124..1768 99 <- Minus
2R 11412632..11412985 770..1123 100 <- Minus
2R 11421258..11421436 591..769 100 <- Minus
2R 11429053..11429641 1..590 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:45 Download gff for RE60324.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11411930..11412574 1124..1768 99 <- Minus
2R 11412632..11412985 770..1123 100 <- Minus
2R 11421258..11421436 591..769 100 <- Minus
2R 11429053..11429641 1..590 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:29:32 Download gff for RE60324.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7299435..7300079 1124..1768 99 <- Minus
arm_2R 7300137..7300490 770..1123 100 <- Minus
arm_2R 7308763..7308941 591..769 100 <- Minus
arm_2R 7316558..7317146 1..590 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:08:36 Download gff for RE60324.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11413129..11413773 1124..1768 99 <- Minus
2R 11413831..11414184 770..1123 100 <- Minus
2R 11422457..11422635 591..769 100 <- Minus
2R 11430252..11430840 1..590 99   Minus

RE60324.pep Sequence

Translation from 574 to 1311

> RE60324.pep
MVEKTEMSKFVGVADITENKKIWRMLLGELVGTFFLIFVGVGSTTSGSVP
QIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIV
QCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIEALITFILV
FVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPA
VVQGVWTYHWVYWVGPIAGGLLAGIIYRLIFKVRKGDDETDSYDF*

RE60324.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12394-PA 245 GF12394-PA 1..245 1..245 1144 90.6 Plus
Dana\GF12555-PA 264 GF12555-PA 1..245 7..243 462 38.8 Plus
Dana\GF11832-PA 266 GF11832-PA 23..247 25..238 365 36.4 Plus
Dana\GF11831-PA 272 GF11831-PA 32..249 26..232 321 37.2 Plus
Dana\GF11830-PA 244 GF11830-PA 12..238 26..242 318 34.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22646-PA 245 GG22646-PA 1..245 1..245 1204 95.1 Plus
Dere\GG20203-PA 264 GG20203-PA 1..245 7..243 444 38.9 Plus
Dere\GG20012-PA 294 GG20012-PA 53..279 26..241 363 37 Plus
Dere\GG20011-PA 271 GG20011-PA 30..253 26..241 351 38.3 Plus
Dere\GG10075-PA 694 GG10075-PA 63..295 21..242 330 35.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20503-PA 247 GH20503-PA 1..247 1..245 1074 83.8 Plus
Dgri\GH21387-PA 264 GH21387-PA 15..245 17..243 450 38.2 Plus
Dgri\GH21221-PA 259 GH21221-PA 24..249 25..239 368 38.5 Plus
Dgri\GH21220-PA 267 GH21220-PA 21..252 17..237 362 38 Plus
Dgri\GH11064-PA 705 GH11064-PA 61..279 21..235 316 34.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:51
Subject Length Description Subject Range Query Range Score Percent Strand
Drip-PB 245 CG9023-PB 1..245 1..245 1244 100 Plus
Drip-PA 245 CG9023-PA 1..245 1..245 1244 100 Plus
Drip-PD 242 CG9023-PD 3..242 6..245 1220 100 Plus
Drip-PC 243 CG9023-PC 4..243 6..245 1220 100 Plus
Drip-PE 239 CG9023-PE 1..239 7..245 1215 100 Plus
Drip-PF 278 CG9023-PF 1..236 1..236 1187 99.2 Plus
Drip-PG 233 CG9023-PG 1..233 1..233 1177 100 Plus
Prip-PD 259 CG7777-PD 1..233 7..234 473 40.4 Plus
Prip-PA 264 CG7777-PA 1..233 7..234 473 40.4 Plus
Prip-PB 268 CG7777-PB 1..233 7..234 473 40.4 Plus
Prip-PC 270 CG7777-PC 1..233 7..234 473 40.4 Plus
bib-PA 696 CG4722-PA 63..295 21..242 365 36.1 Plus
bib-PB 737 CG4722-PB 63..295 21..242 365 36.1 Plus
Eglp3-PB 270 CG17662-PB 32..253 28..241 361 36.9 Plus
Eglp2-PA 265 CG17664-PA 24..250 26..241 356 37 Plus
Eglp2-PC 290 CG17664-PC 49..275 26..241 356 37 Plus
Eglp4-PB 249 CG4019-PB 13..226 27..232 302 35.5 Plus
Eglp4-PD 249 CG4019-PD 13..226 27..232 302 35.5 Plus
Eglp4-PA 249 CG4019-PA 13..226 27..232 302 35.5 Plus
Eglp4-PC 261 CG4019-PC 25..238 27..232 302 35.5 Plus
Eglp4-PE 286 CG4019-PE 50..263 27..232 302 35.5 Plus
Eglp4-PF 297 CG4019-PF 61..274 27..232 302 35.5 Plus
Eglp1-PA 238 CG5398-PA 14..198 29..204 187 30.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21049-PA 247 GI21049-PA 1..247 1..245 1081 84.2 Plus
Dmoj\GI18564-PA 264 GI18564-PA 1..245 7..243 459 39.7 Plus
Dmoj\GI20505-PA 274 GI20505-PA 27..257 18..237 369 38.1 Plus
Dmoj\GI17582-PA 705 GI17582-PA 61..279 21..235 316 34.8 Plus
Dmoj\GI20506-PA 247 GI20506-PA 16..233 26..232 304 34.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10680-PA 135 GL10680-PA 1..122 1..119 463 82.8 Plus
Dper\GL17598-PA 266 GL17598-PA 24..253 25..242 361 38.3 Plus
Dper\GL18952-PA 691 GL18952-PA 61..283 21..239 331 35.1 Plus
Dper\GL17597-PA 272 GL17597-PA 32..252 26..238 309 35.3 Plus
Dper\GL17596-PA 249 GL17596-PA 12..238 26..244 304 36.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24443-PA 244 GA24443-PA 1..244 1..245 1103 88.2 Plus
Dpse\GA20580-PA 264 GA20580-PA 1..245 7..243 460 40.1 Plus
Dpse\GA24838-PA 266 GA24838-PA 24..253 25..242 365 38.7 Plus
Dpse\GA24837-PA 273 GA24837-PA 33..253 26..238 308 35.3 Plus
Dpse\GA17871-PA 249 GA17871-PA 12..238 26..244 304 36.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20426-PA 245 GM20426-PA 1..245 1..245 1241 98.8 Plus
Dsec\GM21291-PA 264 GM21291-PA 1..245 7..243 440 38.9 Plus
Dsec\GM15524-PA 265 GM15524-PA 24..251 26..242 351 36 Plus
Dsec\GM15523-PA 274 GM15523-PA 30..257 26..241 343 36.8 Plus
Dsec\GM17851-PA 684 GM17851-PA 63..295 21..242 317 34.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10798-PA 264 GD10798-PA 1..245 7..243 440 38.9 Plus
Dsim\GD25028-PA 265 GD25028-PA 24..251 26..242 351 36 Plus
Dsim\GD25027-PA 265 GD25027-PA 30..248 26..241 349 37.8 Plus
Dsim\GD23647-PA 674 GD23647-PA 63..295 21..242 330 35.3 Plus
Dsim\GD25901-PA 99 GD25901-PA 1..58 1..58 264 91.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21971-PA 305 GJ21971-PA 64..305 6..245 1007 81 Plus
Dvir\GJ20358-PA 264 GJ20358-PA 1..245 7..243 462 39.7 Plus
Dvir\GJ22357-PA 247 GJ22357-PA 12..241 25..244 371 37.9 Plus
Dvir\bib-PA 700 GJ17924-PA 61..280 21..236 317 35.1 Plus
Dvir\GJ22355-PA 252 GJ22355-PA 12..222 26..228 272 36.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21884-PA 245 GK21884-PA 1..245 1..245 1097 84.5 Plus
Dwil\GK21417-PA 264 GK21417-PA 1..233 7..234 456 40.4 Plus
Dwil\GK23178-PA 270 GK23178-PA 26..254 25..242 337 35.4 Plus
Dwil\GK23177-PA 262 GK23177-PA 20..243 26..241 336 37.9 Plus
Dwil\GK23174-PA 249 GK23174-PA 12..238 26..244 303 37 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13520-PA 245 GE13520-PA 1..245 1..245 1211 95.1 Plus
Dyak\GE12363-PA 264 GE12363-PA 1..245 7..243 440 38.9 Plus
Dyak\GE11549-PA 265 GE11549-PA 24..251 26..242 370 36.8 Plus
Dyak\GE11548-PA 271 GE11548-PA 30..253 26..241 337 36.6 Plus
Dyak\GE18888-PA 699 GE18888-PA 63..295 21..242 325 35.3 Plus

RE60324.hyp Sequence

Translation from 574 to 1311

> RE60324.hyp
MVEKTEMSKFVGVADITENKKIWRMLLGELVGTFFLIFVGVGSTTSGSVP
QIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIV
QCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIEALITFILV
FVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPA
VVQGVWTYHWVYWVGPIAGGLLAGIIYRLIFKVRKGDDETDSYDF*

RE60324.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
Drip-PB 245 CG9023-PB 1..245 1..245 1244 100 Plus
Drip-PA 245 CG9023-PA 1..245 1..245 1244 100 Plus
Drip-PD 242 CG9023-PD 3..242 6..245 1220 100 Plus
Drip-PC 243 CG9023-PC 4..243 6..245 1220 100 Plus
Drip-PE 239 CG9023-PE 1..239 7..245 1215 100 Plus