Clone RE60404 Report

Search the DGRC for RE60404

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:604
Well:4
Vector:pFlc-1
Associated Gene/TranscriptCG12721-RA
Protein status:RE60404.pep: gold
Preliminary Size:519
Sequenced Size:825

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12721 2002-01-01 Sim4 clustering to Release 2
CG12721 2002-05-14 Blastp of sequenced clone
CG12721 2003-01-01 Sim4 clustering to Release 3
CG12721 2008-04-29 Release 5.5 accounting
CG12721 2008-08-15 Release 5.9 accounting
CG12721 2008-12-18 5.12 accounting

Clone Sequence Records

RE60404.complete Sequence

825 bp (825 high quality bases) assembled on 2002-05-14

GenBank Submission: AY119151

> RE60404.complete
GTAATCTATCGGCGTAAGCAGCGTAGCTCTCATAAAACAATAACATTGAG
AACCAGTCATTTCAACCACATTGCTTTGGCTTTGCCATGGCCAAGATATT
GCCCACCGATGGCATCTGGATACCGGAGTCGTGCAGCTTTCCGGAGGATG
TGATGATCGATATGATGGAGGGACTATTCCGCGATGTGCCAAACCTAACG
CACAAGGAGTACCTGGCGCTGGCCGACCTGCAATCTAGATGGATGGCGAA
GCTGGCCAACCGACAGCCGGAATCGAATCCCCTGCCGCCAAAGCCAAAGA
AGCGTAAGAAAATCGCTCCAAAGAAGCAGGACCAGCCTGTCGAGGAGAAG
GGCAGCGAAGTCGACATCTACGATGTGGACGACAACGAGATGGTCAACAA
TCGCATCTACATTCCGCGACTGCGTTCCGCTTGGAGAGCTCGCTATTTCA
ACATTATGATGCGCGCCTTTGTCATCAAACGGGGACTATTGAATAAGCAC
ATTAACTGGCAGATTCTCGACAAGATCATGGCAGCCCCCGACGCAGAGGG
ACAAGCCGAGCTTCAGGCGTTTGTTGACAAAGTGGTCGCAGGCCAGGAAA
TGTAGTCCTTACAGCCTCCTAGGATAAGCACCCAAACACATAGATATGTA
AATTCAAAATATCAATTGTTTACTCAAATTAAAAATAACAATTGTATAAT
CAAATCAACCTTTGTAAAATCATACCAATTGAACATAAGCATAGGTGTGA
AGCAAAACCAGAGCCAATAAACCATACGAATGCCATCGTCTTCTGTGGGC
CAAATCAATAAAAAAAAAAAAAAAA

RE60404.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG12721-RA 812 CG12721-RA 1..811 2..812 4040 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:57:56
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11963016..11963822 808..2 4035 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:07:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 12072005..12072815 812..2 4040 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 12080103..12080913 812..2 4040 99.8 Minus
Blast to na_te.dros performed 2019-03-16 13:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 3984..4148 635..795 203 60 Plus
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 893..996 640..743 115 63.3 Plus

RE60404.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:58:44 Download gff for RE60404.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11963015..11963822 1..809 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:27:57 Download gff for RE60404.complete
Subject Subject Range Query Range Percent Splice Strand
CG12721-RA 1..519 87..605 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:52:16 Download gff for RE60404.complete
Subject Subject Range Query Range Percent Splice Strand
CG12721-RA 1..519 87..605 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:22:51 Download gff for RE60404.complete
Subject Subject Range Query Range Percent Splice Strand
CG12721-RA 1..519 87..605 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:44:56 Download gff for RE60404.complete
Subject Subject Range Query Range Percent Splice Strand
CG12721-RA 1..519 87..605 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:21:41 Download gff for RE60404.complete
Subject Subject Range Query Range Percent Splice Strand
CG12721-RA 1..519 87..605 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:30:23 Download gff for RE60404.complete
Subject Subject Range Query Range Percent Splice Strand
CG12721-RA 1..807 2..809 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:52:15 Download gff for RE60404.complete
Subject Subject Range Query Range Percent Splice Strand
CG12721-RA 11..818 1..809 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:22:51 Download gff for RE60404.complete
Subject Subject Range Query Range Percent Splice Strand
CG12721-RA 3..810 1..809 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:44:56 Download gff for RE60404.complete
Subject Subject Range Query Range Percent Splice Strand
CG12721-RA 1..807 2..809 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:21:41 Download gff for RE60404.complete
Subject Subject Range Query Range Percent Splice Strand
CG12721-RA 3..810 1..809 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:44 Download gff for RE60404.complete
Subject Subject Range Query Range Percent Splice Strand
X 12072008..12072815 1..809 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:44 Download gff for RE60404.complete
Subject Subject Range Query Range Percent Splice Strand
X 12072008..12072815 1..809 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:44 Download gff for RE60404.complete
Subject Subject Range Query Range Percent Splice Strand
X 12072008..12072815 1..809 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:22:51 Download gff for RE60404.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11966041..11966848 1..809 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:17:17 Download gff for RE60404.complete
Subject Subject Range Query Range Percent Splice Strand
X 12080106..12080913 1..809 99   Minus

RE60404.pep Sequence

Translation from 86 to 604

> RE60404.pep
MAKILPTDGIWIPESCSFPEDVMIDMMEGLFRDVPNLTHKEYLALADLQS
RWMAKLANRQPESNPLPPKPKKRKKIAPKKQDQPVEEKGSEVDIYDVDDN
EMVNNRIYIPRLRSAWRARYFNIMMRAFVIKRGLLNKHINWQILDKIMAA
PDAEGQAELQAFVDKVVAGQEM*

RE60404.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19064-PA 214 GF19064-PA 33..199 11..167 205 33.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19560-PA 174 GG19560-PA 6..173 9..172 496 61.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17684-PA 109 GH17684-PA 16..104 80..167 152 37.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:18
Subject Length Description Subject Range Query Range Score Percent Strand
moon-PA 172 CG12721-PA 1..172 1..172 904 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21506-PA 131 GI21506-PA 48..126 89..167 143 34.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14842-PA 323 GL14842-PA 132..312 8..167 209 33.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:56:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26328-PA 287 GA26328-PA 107..276 8..167 215 34.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13218-PA 169 GM13218-PA 1..166 1..166 646 81.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17518-PA 157 GK17518-PA 2..137 37..165 210 37.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16721-PA 182 GE16721-PA 5..172 1..168 544 64.9 Plus

RE60404.hyp Sequence

Translation from 86 to 604

> RE60404.hyp
MAKILPTDGIWIPESCSFPEDVMIDMMEGLFRDVPNLTHKEYLALADLQS
RWMAKLANRQPESNPLPPKPKKRKKIAPKKQDQPVEEKGSEVDIYDVDDN
EMVNNRIYIPRLRSAWRARYFNIMMRAFVIKRGLLNKHINWQILDKIMAA
PDAEGQAELQAFVDKVVAGQEM*

RE60404.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG12721-PA 172 CG12721-PA 1..172 1..172 904 100 Plus