Clone RE60462 Report

Search the DGRC for RE60462

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:604
Well:62
Vector:pFlc-1
Associated Gene/TranscriptCG32736-RA
Protein status:RE60462.pep2: gold RE60462.pep: gold
Preliminary Size:240
Sequenced Size:648

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14429 2002-01-01 Sim4 clustering to Release 2
CG32736 2002-04-26 Blastp of sequenced clone
CG32736 2003-01-01 Sim4 clustering to Release 3
CG32736 2008-04-29 Release 5.5 accounting
CG42308 2008-08-15 Release 5.9 accounting
CG32736 2008-08-15 Release 5.9 accounting
CG32736 2008-12-18 5.12 accounting
CG42308 2008-12-18 5.12 accounting

Clone Sequence Records

RE60462.complete Sequence

648 bp (648 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113525.1

> RE60462.complete
GAGCAGCTGATTGCTGCGAACCGGAACAAATGGAAATTGTATCGTGAGAA
CTAACGCACACATGTGACGGAGGCAATACACAAACACGGCACCTTTGAAT
CTCGCCTTAAAATTGGCGAAACCAACACGGAATTATATAACCGCCGGCTG
AAAACACATGAGTCCGTACAGCGGATCCGTGCGTCGTCTGCTGGACAGTT
GGCCAGGAAAGAAGCGCTTCGGTGTCTACCGCTTCCTGCCGCTCTTCTTT
TTACTGGGCGCCGGCCTGGAATTCTCCATGATCAATTGGACAGTGGGCGA
GACCAATTTCTACCGCACTTTTAAGCGCCGCCAGGCGAAGAACTACGTGG
AAGAGCAGCAGCATCTGCAGGCGCGAGCCGCGAATAACACCAACTAAGCA
AAATGCCCGCCGGAGTTTCCTGGGGCCAGTACCTGAAATTCCTCGGCTGT
GCCCTGGCATCCATGATGGCCGGATCGCAGGCTGTTCACCTTTACTATAA
GCCTCTGGAGGACTTGCGCGTCTACATCGAACAGGAGCAACACAGCACAC
AGGTGGATCCCACCGCAAAGCCACCGGAATCTGCATAACACTGTGTACTA
GACAAGTTATTGGTGACTAAAGCTATTTAAGCAAAAAAAAAAAAAAAA

RE60462.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG32736-RB 630 CG32736-RB 4..630 4..630 3135 100 Plus
CG42308-RA 630 CG42308-RA 4..630 4..630 3135 100 Plus
CG42308-RB 586 CG42308-RB 3..586 47..630 2920 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:33:21
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6903889..6904208 312..631 1570 99.4 Plus
chrX 22417052 chrX 6903564..6903828 47..311 1310 99.6 Plus
chrX 22417052 chrX 6903436..6903480 4..48 180 93.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:07:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7011818..7012137 312..631 1600 100 Plus
X 23542271 X 7011492..7011756 47..311 1325 100 Plus
X 23542271 X 7011364..7011408 4..48 225 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7019916..7020235 312..631 1600 100 Plus
X 23527363 X 7019590..7019854 47..311 1325 100 Plus
X 23527363 X 7019462..7019506 4..48 225 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:33:19 has no hits.

RE60462.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:34:04 Download gff for RE60462.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6903433..6903480 1..48 91 -> Plus
chrX 6903566..6903828 49..311 99 -> Plus
chrX 6903889..6904208 312..632 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:27:59 Download gff for RE60462.complete
Subject Subject Range Query Range Percent Splice Strand
CG32736-RB 1..240 158..397 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:39:07 Download gff for RE60462.complete
Subject Subject Range Query Range Percent Splice Strand
CG32736-RB 1..240 158..397 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:05:09 Download gff for RE60462.complete
Subject Subject Range Query Range Percent Splice Strand
CG32736-RA 1..240 158..397 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:09:14 Download gff for RE60462.complete
Subject Subject Range Query Range Percent Splice Strand
CG32736-RB 1..240 158..397 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:42:08 Download gff for RE60462.complete
Subject Subject Range Query Range Percent Splice Strand
CG32736-RA 1..240 158..397 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:04:10 Download gff for RE60462.complete
Subject Subject Range Query Range Percent Splice Strand
CG42308-RA 1..630 1..630 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:39:07 Download gff for RE60462.complete
Subject Subject Range Query Range Percent Splice Strand
CG42308-RA 1..630 1..630 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:05:09 Download gff for RE60462.complete
Subject Subject Range Query Range Percent Splice Strand
CG42308-RA 5..635 1..631 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:09:14 Download gff for RE60462.complete
Subject Subject Range Query Range Percent Splice Strand
CG42308-RA 1..630 1..630 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:42:08 Download gff for RE60462.complete
Subject Subject Range Query Range Percent Splice Strand
CG32736-RB 5..635 1..631 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:34:04 Download gff for RE60462.complete
Subject Subject Range Query Range Percent Splice Strand
X 7011361..7011408 1..48 97 -> Plus
X 7011494..7011756 49..311 100 -> Plus
X 7011818..7012137 312..632 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:34:04 Download gff for RE60462.complete
Subject Subject Range Query Range Percent Splice Strand
X 7011361..7011408 1..48 97 -> Plus
X 7011494..7011756 49..311 100 -> Plus
X 7011818..7012137 312..632 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:34:04 Download gff for RE60462.complete
Subject Subject Range Query Range Percent Splice Strand
X 7011361..7011408 1..48 97 -> Plus
X 7011494..7011756 49..311 100 -> Plus
X 7011818..7012137 312..632 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:05:09 Download gff for RE60462.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6905851..6906170 312..632 99   Plus
arm_X 6905394..6905441 1..48 97 -> Plus
arm_X 6905527..6905789 49..311 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:43:24 Download gff for RE60462.complete
Subject Subject Range Query Range Percent Splice Strand
X 7019592..7019854 49..311 100 -> Plus
X 7019916..7020235 312..632 99   Plus
X 7019459..7019506 1..48 97 -> Plus

RE60462.hyp Sequence

Translation from 157 to 396

> RE60462.hyp
MSPYSGSVRRLLDSWPGKKRFGVYRFLPLFFLLGAGLEFSMINWTVGETN
FYRTFKRRQAKNYVEEQQHLQARAANNTN*

RE60462.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG32736-PB 79 CG32736-PB 1..79 1..79 421 100 Plus
CG32736-PA 79 CG32736-PA 1..79 1..79 421 100 Plus

RE60462.pep Sequence

Translation from 157 to 396

> RE60462.pep
MSPYSGSVRRLLDSWPGKKRFGVYRFLPLFFLLGAGLEFSMINWTVGETN
FYRTFKRRQAKNYVEEQQHLQARAANNTN*

RE60462.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20358-PA 79 GF20358-PA 1..78 1..78 380 91 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19627-PA 79 GG19627-PA 1..79 1..79 401 96.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12101-PA 82 GH12101-PA 1..64 1..64 298 85.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG32736-PB 79 CG32736-PB 1..79 1..79 421 100 Plus
CG32736-PA 79 CG32736-PA 1..79 1..79 421 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21670-PA 79 GI21670-PA 1..66 1..66 306 83.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26821-PA 79 GL26821-PA 1..66 1..66 323 90.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17109-PA 79 GA17109-PA 1..66 1..66 323 90.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17499-PA 79 GM17499-PA 1..78 1..78 408 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16827-PA 79 GD16827-PA 1..79 1..79 410 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15794-PA 84 GJ15794-PA 1..69 1..69 328 87 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25637-PA 73 GK25637-PA 1..67 1..67 302 82.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15695-PA 79 GE15695-PA 1..79 1..79 392 92.4 Plus

RE60462.pep2 Sequence

Translation from 402 to 587

> RE60462.pep2
MPAGVSWGQYLKFLGCALASMMAGSQAVHLYYKPLEDLRVYIEQEQHSTQ
VDPTAKPPESA*

RE60462.pep2 Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:16:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20360-PA 61 GF20360-PA 1..48 1..48 207 79.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:16:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19628-PA 61 GG19628-PA 1..61 1..61 301 91.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:16:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12102-PA 64 GH12102-PA 1..44 1..44 194 84.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG42308-PB 61 CG42308-PB 1..61 1..61 323 100 Plus
CG42308-PA 61 CG42308-PA 1..61 1..61 323 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:16:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21671-PA 58 GI21671-PA 1..50 1..50 201 72 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:16:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26822-PA 56 GL26822-PA 1..46 1..46 201 82.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:16:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22652-PA 56 GA22652-PA 1..46 1..46 202 82.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:16:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17500-PA 61 GM17500-PA 1..61 1..61 310 95.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:16:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16828-PA 61 GD16828-PA 1..61 1..61 304 93.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:16:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15795-PA 50 GJ15795-PA 1..41 11..53 158 72.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:16:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15696-PA 61 GE15696-PA 1..61 1..61 303 93.4 Plus