BDGP Sequence Production Resources |
Search the DGRC for RE60462
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 604 |
Well: | 62 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG32736-RA |
Protein status: | RE60462.pep2: gold RE60462.pep: gold |
Preliminary Size: | 240 |
Sequenced Size: | 648 |
Gene | Date | Evidence |
---|---|---|
CG14429 | 2002-01-01 | Sim4 clustering to Release 2 |
CG32736 | 2002-04-26 | Blastp of sequenced clone |
CG32736 | 2003-01-01 | Sim4 clustering to Release 3 |
CG32736 | 2008-04-29 | Release 5.5 accounting |
CG42308 | 2008-08-15 | Release 5.9 accounting |
CG32736 | 2008-08-15 | Release 5.9 accounting |
CG32736 | 2008-12-18 | 5.12 accounting |
CG42308 | 2008-12-18 | 5.12 accounting |
648 bp (648 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113525.1
> RE60462.complete GAGCAGCTGATTGCTGCGAACCGGAACAAATGGAAATTGTATCGTGAGAA CTAACGCACACATGTGACGGAGGCAATACACAAACACGGCACCTTTGAAT CTCGCCTTAAAATTGGCGAAACCAACACGGAATTATATAACCGCCGGCTG AAAACACATGAGTCCGTACAGCGGATCCGTGCGTCGTCTGCTGGACAGTT GGCCAGGAAAGAAGCGCTTCGGTGTCTACCGCTTCCTGCCGCTCTTCTTT TTACTGGGCGCCGGCCTGGAATTCTCCATGATCAATTGGACAGTGGGCGA GACCAATTTCTACCGCACTTTTAAGCGCCGCCAGGCGAAGAACTACGTGG AAGAGCAGCAGCATCTGCAGGCGCGAGCCGCGAATAACACCAACTAAGCA AAATGCCCGCCGGAGTTTCCTGGGGCCAGTACCTGAAATTCCTCGGCTGT GCCCTGGCATCCATGATGGCCGGATCGCAGGCTGTTCACCTTTACTATAA GCCTCTGGAGGACTTGCGCGTCTACATCGAACAGGAGCAACACAGCACAC AGGTGGATCCCACCGCAAAGCCACCGGAATCTGCATAACACTGTGTACTA GACAAGTTATTGGTGACTAAAGCTATTTAAGCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 6903889..6904208 | 312..631 | 1570 | 99.4 | Plus |
chrX | 22417052 | chrX | 6903564..6903828 | 47..311 | 1310 | 99.6 | Plus |
chrX | 22417052 | chrX | 6903436..6903480 | 4..48 | 180 | 93.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 6903433..6903480 | 1..48 | 91 | -> | Plus |
chrX | 6903566..6903828 | 49..311 | 99 | -> | Plus |
chrX | 6903889..6904208 | 312..632 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32736-RB | 1..240 | 158..397 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32736-RB | 1..240 | 158..397 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32736-RA | 1..240 | 158..397 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32736-RB | 1..240 | 158..397 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32736-RA | 1..240 | 158..397 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42308-RA | 1..630 | 1..630 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42308-RA | 1..630 | 1..630 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42308-RA | 5..635 | 1..631 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42308-RA | 1..630 | 1..630 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32736-RB | 5..635 | 1..631 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 7011361..7011408 | 1..48 | 97 | -> | Plus |
X | 7011494..7011756 | 49..311 | 100 | -> | Plus |
X | 7011818..7012137 | 312..632 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 7011361..7011408 | 1..48 | 97 | -> | Plus |
X | 7011494..7011756 | 49..311 | 100 | -> | Plus |
X | 7011818..7012137 | 312..632 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 7011361..7011408 | 1..48 | 97 | -> | Plus |
X | 7011494..7011756 | 49..311 | 100 | -> | Plus |
X | 7011818..7012137 | 312..632 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 6905851..6906170 | 312..632 | 99 | Plus | |
arm_X | 6905394..6905441 | 1..48 | 97 | -> | Plus |
arm_X | 6905527..6905789 | 49..311 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 7019592..7019854 | 49..311 | 100 | -> | Plus |
X | 7019916..7020235 | 312..632 | 99 | Plus | |
X | 7019459..7019506 | 1..48 | 97 | -> | Plus |
Translation from 157 to 396
> RE60462.hyp MSPYSGSVRRLLDSWPGKKRFGVYRFLPLFFLLGAGLEFSMINWTVGETN FYRTFKRRQAKNYVEEQQHLQARAANNTN*
Translation from 157 to 396
> RE60462.pep MSPYSGSVRRLLDSWPGKKRFGVYRFLPLFFLLGAGLEFSMINWTVGETN FYRTFKRRQAKNYVEEQQHLQARAANNTN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20358-PA | 79 | GF20358-PA | 1..78 | 1..78 | 380 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19627-PA | 79 | GG19627-PA | 1..79 | 1..79 | 401 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12101-PA | 82 | GH12101-PA | 1..64 | 1..64 | 298 | 85.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32736-PB | 79 | CG32736-PB | 1..79 | 1..79 | 421 | 100 | Plus |
CG32736-PA | 79 | CG32736-PA | 1..79 | 1..79 | 421 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21670-PA | 79 | GI21670-PA | 1..66 | 1..66 | 306 | 83.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26821-PA | 79 | GL26821-PA | 1..66 | 1..66 | 323 | 90.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17109-PA | 79 | GA17109-PA | 1..66 | 1..66 | 323 | 90.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17499-PA | 79 | GM17499-PA | 1..78 | 1..78 | 408 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16827-PA | 79 | GD16827-PA | 1..79 | 1..79 | 410 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15794-PA | 84 | GJ15794-PA | 1..69 | 1..69 | 328 | 87 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25637-PA | 73 | GK25637-PA | 1..67 | 1..67 | 302 | 82.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE15695-PA | 79 | GE15695-PA | 1..79 | 1..79 | 392 | 92.4 | Plus |
Translation from 402 to 587
> RE60462.pep2 MPAGVSWGQYLKFLGCALASMMAGSQAVHLYYKPLEDLRVYIEQEQHSTQ VDPTAKPPESA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20360-PA | 61 | GF20360-PA | 1..48 | 1..48 | 207 | 79.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19628-PA | 61 | GG19628-PA | 1..61 | 1..61 | 301 | 91.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12102-PA | 64 | GH12102-PA | 1..44 | 1..44 | 194 | 84.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42308-PB | 61 | CG42308-PB | 1..61 | 1..61 | 323 | 100 | Plus |
CG42308-PA | 61 | CG42308-PA | 1..61 | 1..61 | 323 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21671-PA | 58 | GI21671-PA | 1..50 | 1..50 | 201 | 72 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26822-PA | 56 | GL26822-PA | 1..46 | 1..46 | 201 | 82.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA22652-PA | 56 | GA22652-PA | 1..46 | 1..46 | 202 | 82.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17500-PA | 61 | GM17500-PA | 1..61 | 1..61 | 310 | 95.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16828-PA | 61 | GD16828-PA | 1..61 | 1..61 | 304 | 93.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15795-PA | 50 | GJ15795-PA | 1..41 | 11..53 | 158 | 72.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE15696-PA | 61 | GE15696-PA | 1..61 | 1..61 | 303 | 93.4 | Plus |