Clone RE60471 Report

Search the DGRC for RE60471

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:604
Well:71
Vector:pFlc-1
Associated Gene/TranscriptMdh2-RA
Protein status:RE60471.pep: gold
Sequenced Size:1328

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7998 2002-01-01 Sim4 clustering to Release 2
CG7998 2002-05-14 Blastp of sequenced clone
CG7998 2003-01-01 Sim4 clustering to Release 3
CG7998 2008-04-29 Release 5.5 accounting
CG7998 2008-08-15 Release 5.9 accounting
CG7998 2008-12-18 5.12 accounting

Clone Sequence Records

RE60471.complete Sequence

1328 bp (1328 high quality bases) assembled on 2002-05-14

GenBank Submission: AY119152

> RE60471.complete
GATTCGCAAATCTGTTTCATTGGCCCGTGGGATTTTGCTGGCAGAACTGC
TCTCGTTTAATTGTTTTAACCAATACATTTTGTAACCAAAACCCGTGCAA
ATATGCTGAAGCAAGTGACGAAGCAATTGGCCCTGCAGGGAGTGCGCACC
TTCTCGGTTGGCCAGCAGAACAACTACAAGGTGACCGTTTGCGGTGCCGC
TGGAGGAATCGGCCAGCCGCTGTCGCTGCTCCTCAAGCAGAATCCCCTGG
TCACCGACTTGGCGCTCTACGATATCGTTCATACGCCCGGTGTGGCCGCC
GATCTGTCGCATATCGACACCAAGAGCAAGACCGCCGGATTCATCGGAGC
CGACCAGCTGGGTGACTCCCTGAAGGGATCCGATGTGGTGGTCATTCCCG
CTGGTGTGCCCCGCAAGCCGGGCATGACCCGCGATGATCTGTTCAACGTG
AACGCCGGCATCATCAAGGACATCTCCAACTCCATTGCCAAGAACTGCCC
CAAGGCCCTGGTGGCCATCATCACCAACCCGGTGAACACCTGCGTGCCCA
TCGCTGCCGAGATCCTCAAGAAGGCTGGTGTTTACGATCCCAAGCGTCTG
TTCGGAGTCTCCACCTTGGATGTGGTGCGTGCCCGTGCCTTCATCGGCCA
TGCCCTTGGTGTGGATCCCCAGACCGTGCAGATCCCCGTGATCGGCGGCC
ACTCCGGCGTGACCATCCTGCCTGTGCTCTCCCAGAGCCAGCCCCTGTTC
AAGGGCAACCAGGACACCATCGAGAAGCTTACCGTGCGCATCCAGGAGGC
CGGTACTGAGGTCGTTAAGGCCAAGGCCGGAGCCGGTTCCGCCACTCTGT
CGATGGCCTACGCTGGTGCCCGTTTCGCCGGCTCCCTGCTGAAGGGACTG
AACGGCGAGAAGAACGTTATCGAGTGCTCCTACGTGCAGTCCACCGTCAC
GGAGGCTACCTTCTTCTCCACACCCCTGGTGCTGGGCAAGAACGGCGTCC
AGGAGAACCTCGGCCTGCCCAAGCTCAACGACTACGAGAAGAAGCTGCTG
GAGGCCGCCATTCCCGAGCTGAAGAAGAACATCCAGAAGGGCATTGACTT
TGCCAACGCCTAAGCGATCCAACAAATCCCATCCGCTACCAAAAAATCGT
GTACTTCATTAGCGCCTATTGTGAATTGGCAAACTACCCATACTACCCCT
AGCAAATCTTTCGTCTCAAGTCGGCGTGTCCCAAGATTATATAGATCTGC
GCCTAGTGTGTGGTGTAAAATGAAACCAGTTGATATCTGAAATAAATAAA
TTGTAAACTTGGAAAAAAAAAAAAAAAA

RE60471.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG7998.b 1791 CG7998.b 229..1546 1..1318 6590 100 Plus
CG7998-RA 1791 CG7998-RA 229..1546 1..1318 6590 100 Plus
CG7998.c 1561 CG7998.c 229..1546 1..1318 6590 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:26:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14052252..14052992 572..1312 3705 100 Plus
chr3R 27901430 chr3R 14051022..14051232 167..377 1055 100 Plus
chr3R 27901430 chr3R 14051998..14052196 376..574 995 100 Plus
chr3R 27901430 chr3R 14050693..14050860 1..168 840 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:07:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18227958..18228704 572..1318 3735 100 Plus
3R 32079331 3R 18226728..18226938 167..377 1055 100 Plus
3R 32079331 3R 18227704..18227902 376..574 995 100 Plus
3R 32079331 3R 18226399..18226566 1..168 840 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17968789..17969535 572..1318 3735 100 Plus
3R 31820162 3R 17967559..17967769 167..377 1055 100 Plus
3R 31820162 3R 17968535..17968733 376..574 995 100 Plus
3R 31820162 3R 17967230..17967397 1..168 840 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:26:16 has no hits.

RE60471.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:27:06 Download gff for RE60471.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14050693..14050860 1..168 100 -> Plus
chr3R 14051024..14051231 169..376 100 -> Plus
chr3R 14051999..14052195 377..573 100 -> Plus
chr3R 14052254..14052992 574..1312 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:28:00 Download gff for RE60471.complete
Subject Subject Range Query Range Percent Splice Strand
CG7998-RA 1..1011 103..1113 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:52:17 Download gff for RE60471.complete
Subject Subject Range Query Range Percent Splice Strand
Mdh2-RA 1..1011 103..1113 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:12:49 Download gff for RE60471.complete
Subject Subject Range Query Range Percent Splice Strand
Mdh2-RA 1..1011 103..1113 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:44:57 Download gff for RE60471.complete
Subject Subject Range Query Range Percent Splice Strand
CG7998-RA 1..1011 103..1113 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:21:32 Download gff for RE60471.complete
Subject Subject Range Query Range Percent Splice Strand
Mdh2-RA 1..1011 103..1113 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:30:24 Download gff for RE60471.complete
Subject Subject Range Query Range Percent Splice Strand
CG7998-RA 9..1320 1..1312 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:52:17 Download gff for RE60471.complete
Subject Subject Range Query Range Percent Splice Strand
Mdh2-RA 9..1320 1..1312 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:12:49 Download gff for RE60471.complete
Subject Subject Range Query Range Percent Splice Strand
Mdh2-RA 4..1315 1..1312 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:44:57 Download gff for RE60471.complete
Subject Subject Range Query Range Percent Splice Strand
CG7998-RA 9..1320 1..1312 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:21:32 Download gff for RE60471.complete
Subject Subject Range Query Range Percent Splice Strand
Mdh2-RA 4..1315 1..1312 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:27:06 Download gff for RE60471.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18226399..18226566 1..168 100 -> Plus
3R 18226730..18226937 169..376 100 -> Plus
3R 18227705..18227901 377..573 100 -> Plus
3R 18227960..18228698 574..1312 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:27:06 Download gff for RE60471.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18226399..18226566 1..168 100 -> Plus
3R 18226730..18226937 169..376 100 -> Plus
3R 18227705..18227901 377..573 100 -> Plus
3R 18227960..18228698 574..1312 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:27:06 Download gff for RE60471.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18226399..18226566 1..168 100 -> Plus
3R 18226730..18226937 169..376 100 -> Plus
3R 18227705..18227901 377..573 100 -> Plus
3R 18227960..18228698 574..1312 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:12:49 Download gff for RE60471.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14052121..14052288 1..168 100 -> Plus
arm_3R 14052452..14052659 169..376 100 -> Plus
arm_3R 14053427..14053623 377..573 100 -> Plus
arm_3R 14053682..14054420 574..1312 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:17:18 Download gff for RE60471.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17968791..17969529 574..1312 100   Plus
3R 17967230..17967397 1..168 100 -> Plus
3R 17967561..17967768 169..376 100 -> Plus
3R 17968536..17968732 377..573 100 -> Plus

RE60471.pep Sequence

Translation from 102 to 1112

> RE60471.pep
MLKQVTKQLALQGVRTFSVGQQNNYKVTVCGAAGGIGQPLSLLLKQNPLV
TDLALYDIVHTPGVAADLSHIDTKSKTAGFIGADQLGDSLKGSDVVVIPA
GVPRKPGMTRDDLFNVNAGIIKDISNSIAKNCPKALVAIITNPVNTCVPI
AAEILKKAGVYDPKRLFGVSTLDVVRARAFIGHALGVDPQTVQIPVIGGH
SGVTILPVLSQSQPLFKGNQDTIEKLTVRIQEAGTEVVKAKAGAGSATLS
MAYAGARFAGSLLKGLNGEKNVIECSYVQSTVTEATFFSTPLVLGKNGVQ
ENLGLPKLNDYEKKLLEAAIPELKKNIQKGIDFANA*

RE60471.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23071-PA 336 GF23071-PA 1..336 1..336 1714 97.9 Plus
Dana\GF23749-PA 356 GF23749-PA 33..352 22..335 909 55.6 Plus
Dana\GF10673-PA 353 GF10673-PA 23..335 23..335 908 54 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22759-PA 336 GG22759-PA 1..336 1..336 1738 99.7 Plus
Dere\GG15612-PA 347 GG15612-PA 29..336 26..331 885 55.2 Plus
Dere\GG13791-PA 353 GG13791-PA 36..333 38..335 845 50.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:56:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18558-PA 336 GH18558-PA 1..336 1..336 1671 94.6 Plus
Dgri\GH21421-PA 367 GH21421-PA 28..341 22..335 949 55.9 Plus
Dgri\GH21422-PA 331 GH21422-PA 31..328 36..333 916 57 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
Mdh2-PA 336 CG7998-PA 1..336 1..336 1688 100 Plus
CG10749-PA 347 CG10749-PA 29..336 26..331 898 57.5 Plus
CG10748-PA 349 CG10748-PA 24..332 26..334 856 52.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:56:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24757-PA 336 GI24757-PA 1..336 1..336 1690 96.1 Plus
Dmoj\GI18597-PA 382 GI18597-PA 34..348 22..334 970 59.4 Plus
Dmoj\GI18598-PA 338 GI18598-PA 28..333 26..331 929 56.5 Plus
Dmoj\GI14636-PA 322 GI14636-PA 6..316 22..332 885 53.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12005-PA 336 GL12005-PA 1..336 1..336 1660 93.8 Plus
Dper\GL25264-PA 354 GL25264-PA 27..348 18..336 957 57.1 Plus
Dper\GL10476-PA 383 GL10476-PA 1..302 1..305 877 56.9 Plus
Dper\GL24873-PA 344 GL24873-PA 19..282 38..301 726 52.3 Plus
Dper\GL16414-PA 240 GL16414-PA 1..237 97..333 697 57.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20754-PA 336 GA20754-PA 1..336 1..336 1660 93.8 Plus
Dpse\GA24380-PA 350 GA24380-PA 1..331 1..334 972 56.7 Plus
Dpse\GA10541-PA 354 GA10541-PA 27..348 18..336 950 56.8 Plus
Dpse\GA22565-PA 346 GA22565-PA 28..343 18..333 882 55.4 Plus
Dpse\GA10540-PA 340 GA10540-PA 38..334 38..334 881 55.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15290-PA 336 GM15290-PA 1..336 1..336 1742 100 Plus
Dsec\GM25384-PA 347 GM25384-PA 29..338 26..333 926 57.4 Plus
Dsec\GM24618-PA 349 GM24618-PA 36..332 38..334 860 52.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:56:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19217-PA 329 GD19217-PA 1..329 1..336 1690 97.9 Plus
Dsim\GD12684-PA 349 GD12684-PA 36..332 38..334 859 52.9 Plus
Dsim\GD14416-PA 255 GD14416-PA 1..244 90..331 736 57.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:56:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22544-PA 336 GJ22544-PA 1..336 1..336 1671 95.2 Plus
Dvir\GJ20394-PA 341 GJ20394-PA 1..341 1..336 983 53.5 Plus
Dvir\GJ20393-PA 380 GJ20393-PA 37..349 24..334 973 59.4 Plus
Dvir\GJ19287-PA 317 GJ19287-PA 4..316 21..333 952 56.5 Plus
Dvir\GJ21641-PA 343 GJ21641-PA 33..334 26..323 163 26 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22386-PA 336 GK22386-PA 1..336 1..336 1707 97.6 Plus
Dwil\GK19917-PA 340 GK19917-PA 13..337 12..333 927 54.8 Plus
Dwil\GK22135-PA 343 GK22135-PA 5..336 8..335 925 52.4 Plus
Dwil\GK22161-PA 346 GK22161-PA 37..334 38..335 883 55.4 Plus
Dwil\GK22134-PA 123 GK22134-PA 16..102 248..334 193 47.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25523-PA 336 GE25523-PA 1..336 1..336 1737 99.7 Plus
Dyak\GE21938-PA 347 GE21938-PA 29..336 26..331 904 57.1 Plus
Dyak\GE20084-PA 349 GE20084-PA 36..333 38..335 850 52 Plus

RE60471.hyp Sequence

Translation from 102 to 1112

> RE60471.hyp
MLKQVTKQLALQGVRTFSVGQQNNYKVTVCGAAGGIGQPLSLLLKQNPLV
TDLALYDIVHTPGVAADLSHIDTKSKTAGFIGADQLGDSLKGSDVVVIPA
GVPRKPGMTRDDLFNVNAGIIKDISNSIAKNCPKALVAIITNPVNTCVPI
AAEILKKAGVYDPKRLFGVSTLDVVRARAFIGHALGVDPQTVQIPVIGGH
SGVTILPVLSQSQPLFKGNQDTIEKLTVRIQEAGTEVVKAKAGAGSATLS
MAYAGARFAGSLLKGLNGEKNVIECSYVQSTVTEATFFSTPLVLGKNGVQ
ENLGLPKLNDYEKKLLEAAIPELKKNIQKGIDFANA*

RE60471.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
Mdh2-PA 336 CG7998-PA 1..336 1..336 1688 100 Plus
CG10749-PA 347 CG10749-PA 29..336 26..331 898 57.5 Plus
CG10748-PA 349 CG10748-PA 24..332 26..334 856 52.4 Plus