Clone RE60835 Report

Search the DGRC for RE60835

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:608
Well:35
Vector:pFlc-1
Associated Gene/TranscriptCG16865-RA
Protein status:RE60835.pep: gold
Preliminary Size:744
Sequenced Size:925

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16865 2002-01-01 Sim4 clustering to Release 2
CG16865 2002-04-26 Blastp of sequenced clone
CG16865 2008-04-29 Release 5.5 accounting
CG16865 2008-08-15 Release 5.9 accounting
CG16865 2008-12-18 5.12 accounting

Clone Sequence Records

RE60835.complete Sequence

925 bp (925 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113531

> RE60835.complete
GTTTACCTTTTGCTTGCACACTCTGGTCTCACTGTTTATTTATTTACTTG
CGGTGTTTAATGAAATAGGAAATTACTTTAATTTTATAAGTTTCATAAGT
CCGAAACCCACAAATAACCATGCCCAAAGTAGTGTCGCGCAGTATCGTCT
GCTCCGATACCAAGGATCAGGAGGAGTACAACGAGGAAAAGCCGCTAAAC
ATTTACTACTGTCTGTGCAACAAGATGGCTCTGATTCTGGATTGCACCCT
CGAACAGTTGCCGCTACGAGAGGTGGACAACGCCCGTGTGATAAACGCCA
ACGACCATGCCAACAAACTCACCCACAATCCCACACCGAGGATGGTCTAC
ATCAAACGCAAGAGCAGGGGCAATGGGATCGAGAAGCAGTACCGCTACAA
GTGCCGAAGCTGCAGTCTGCCGCTTTACTATCGCCACAGTCCCGACTCCC
ACGTAACCTTCGTCATGTCCAATGCCCTAATCCGCAACAAGGGTGAGAGT
CCTCTCACACAGCTGCTGAATTCGGAGATCAAGGGCAGTTTCAAGGCACC
GGCTGCCAAGCCAGCGACTTCCGCCGGTCCAGACGATTCGGGTATTGTGG
ATGCCAGTGGCAAGAAGGTCGTCGTCACCAGACACACGAAGAACATGGGC
AAGTTCAGCTCGGTCACGGTGTCTACCATCGACGAGGAGGAGGATGAAAT
CGAGGCGCGCGAGATCGCAGACAGCTATGCGAACAACGCAAGGATTATCG
AGAAGCAACTGCAGCGCAAAGGCGGAAAATTGAGCGATGTGGGCATCAAA
ACCAAGACAGAGGACGCACCTCCGCCGCAGAAGAAGCAGCGCGGCACGCT
ACTGGAAAGATAGTCACACTCTGCCTCCTTATTACCCACAACTAAATATA
TTTGACGACGCAAAAAAAAAAAAAA

RE60835.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG16865-RA 931 CG16865-RA 1..914 1..914 4555 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13810761..13811068 400..707 1540 100 Plus
chr2L 23010047 chr2L 13810237..13810476 1..240 1200 100 Plus
chr2L 23010047 chr2L 13811189..13811391 707..909 1000 99.5 Plus
chr2L 23010047 chr2L 13810536..13810697 240..401 810 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:07:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13812050..13812357 400..707 1540 100 Plus
2L 23513712 2L 13811526..13811765 1..240 1200 100 Plus
2L 23513712 2L 13812478..13812685 707..914 1025 99.5 Plus
2L 23513712 2L 13811825..13811986 240..401 810 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13812050..13812357 400..707 1540 100 Plus
2L 23513712 2L 13811526..13811765 1..240 1200 100 Plus
2L 23513712 2L 13812478..13812685 707..914 1025 99.5 Plus
2L 23513712 2L 13811825..13811986 240..401 810 100 Plus
Blast to na_te.dros performed 2019-03-16 21:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
Cr1a 4470 Cr1a DMCR1A 4470bp 195..254 780..718 109 68.3 Minus

RE60835.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:19:35 Download gff for RE60835.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13810537..13810697 241..401 100 -> Plus
chr2L 13810763..13811068 402..707 100 -> Plus
chr2L 13811190..13811393 708..911 99   Plus
chr2L 13810237..13810476 1..240 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:28:12 Download gff for RE60835.complete
Subject Subject Range Query Range Percent Splice Strand
CG16865-RA 1..744 120..863 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:55:15 Download gff for RE60835.complete
Subject Subject Range Query Range Percent Splice Strand
CG16865-RA 1..744 120..863 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:37:07 Download gff for RE60835.complete
Subject Subject Range Query Range Percent Splice Strand
CG16865-RA 1..744 120..863 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:47:57 Download gff for RE60835.complete
Subject Subject Range Query Range Percent Splice Strand
CG16865-RA 1..744 120..863 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:14:58 Download gff for RE60835.complete
Subject Subject Range Query Range Percent Splice Strand
CG16865-RA 1..744 120..863 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:34:24 Download gff for RE60835.complete
Subject Subject Range Query Range Percent Splice Strand
CG16865-RA 1..911 1..911 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:55:15 Download gff for RE60835.complete
Subject Subject Range Query Range Percent Splice Strand
CG16865-RA 1..911 1..911 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:37:07 Download gff for RE60835.complete
Subject Subject Range Query Range Percent Splice Strand
CG16865-RA 5..915 1..911 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:47:57 Download gff for RE60835.complete
Subject Subject Range Query Range Percent Splice Strand
CG16865-RA 1..911 1..911 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:14:58 Download gff for RE60835.complete
Subject Subject Range Query Range Percent Splice Strand
CG16865-RA 5..915 1..911 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:35 Download gff for RE60835.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13811526..13811765 1..240 100 -> Plus
2L 13811826..13811986 241..401 100 -> Plus
2L 13812052..13812357 402..707 100 -> Plus
2L 13812479..13812682 708..911 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:35 Download gff for RE60835.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13811526..13811765 1..240 100 -> Plus
2L 13811826..13811986 241..401 100 -> Plus
2L 13812052..13812357 402..707 100 -> Plus
2L 13812479..13812682 708..911 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:35 Download gff for RE60835.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13811526..13811765 1..240 100 -> Plus
2L 13811826..13811986 241..401 100 -> Plus
2L 13812052..13812357 402..707 100 -> Plus
2L 13812479..13812682 708..911 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:37:07 Download gff for RE60835.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13811526..13811765 1..240 100 -> Plus
arm_2L 13811826..13811986 241..401 100 -> Plus
arm_2L 13812052..13812357 402..707 100 -> Plus
arm_2L 13812479..13812682 708..911 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:20:23 Download gff for RE60835.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13811526..13811765 1..240 100 -> Plus
2L 13811826..13811986 241..401 100 -> Plus
2L 13812052..13812357 402..707 100 -> Plus
2L 13812479..13812682 708..911 99   Plus

RE60835.pep Sequence

Translation from 119 to 862

> RE60835.pep
MPKVVSRSIVCSDTKDQEEYNEEKPLNIYYCLCNKMALILDCTLEQLPLR
EVDNARVINANDHANKLTHNPTPRMVYIKRKSRGNGIEKQYRYKCRSCSL
PLYYRHSPDSHVTFVMSNALIRNKGESPLTQLLNSEIKGSFKAPAAKPAT
SAGPDDSGIVDASGKKVVVTRHTKNMGKFSSVTVSTIDEEEDEIEAREIA
DSYANNARIIEKQLQRKGGKLSDVGIKTKTEDAPPPQKKQRGTLLER*

RE60835.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14258-PA 247 GF14258-PA 1..247 1..247 1064 85.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23882-PA 247 GG23882-PA 1..247 1..247 1193 93.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11115-PA 247 GH11115-PA 1..247 1..247 990 81.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG16865-PB 247 CG16865-PB 1..247 1..247 1280 100 Plus
CG16865-PA 247 CG16865-PA 1..247 1..247 1280 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18239-PA 261 GI18239-PA 1..261 1..247 952 75.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21231-PA 250 GL21231-PA 1..250 1..247 1044 84.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14184-PA 250 GA14184-PA 1..250 1..247 1033 84 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15233-PA 247 GM15233-PA 1..247 1..247 1293 98 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23925-PA 247 GD23925-PA 1..247 1..247 1293 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18145-PA 252 GJ18145-PA 1..252 1..247 1015 79.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:56:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24797-PA 250 GK24797-PA 1..250 1..247 1036 82.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:56:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18683-PA 247 GE18683-PA 1..247 1..247 1271 96.4 Plus

RE60835.hyp Sequence

Translation from 119 to 862

> RE60835.hyp
MPKVVSRSIVCSDTKDQEEYNEEKPLNIYYCLCNKMALILDCTLEQLPLR
EVDNARVINANDHANKLTHNPTPRMVYIKRKSRGNGIEKQYRYKCRSCSL
PLYYRHSPDSHVTFVMSNALIRNKGESPLTQLLNSEIKGSFKAPAAKPAT
SAGPDDSGIVDASGKKVVVTRHTKNMGKFSSVTVSTIDEEEDEIEAREIA
DSYANNARIIEKQLQRKGGKLSDVGIKTKTEDAPPPQKKQRGTLLER*

RE60835.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG16865-PB 247 CG16865-PB 1..247 1..247 1280 100 Plus
CG16865-PA 247 CG16865-PA 1..247 1..247 1280 100 Plus