Clone RE60882 Report

Search the DGRC for RE60882

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:608
Well:82
Vector:pFlc-1
Associated Gene/Transcriptl(2)34Fc-RA
Protein status:RE60882.pep: gold
Sequenced Size:669

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7532 2002-01-01 Sim4 clustering to Release 2
CG7532 2002-04-26 Blastp of sequenced clone
CG7532 2003-01-01 Sim4 clustering to Release 3
CG7532 2008-04-29 Release 5.5 accounting
CG7532 2008-08-15 Release 5.9 accounting
CG7532 2008-12-18 5.12 accounting

Clone Sequence Records

RE60882.complete Sequence

669 bp (669 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113534

> RE60882.complete
AGCTCATTTCAAGTTTTTCTTTTCTGCCGCTTGTGTGTGTGTATTTCTGA
TCGATATGTTCCGTTTGTTGGTTCTTGCGGCCTGCCTGGCCATCAGTGTC
CACGCCTACTCCGATGGTGCTCCAAAGGCCGCCTGTCGTGACCTGACGCC
CCAGCACGGAGCCAAGCTGCAGGTGACCAAGCCGCCGTACAGCATCTCCG
GACCCTCCCATGTGCGCTCGGATCAAAAGCTGACCCTGACGCTGGGCGGC
GATGAGTTCCTTGGCTTCATGATCCAGGCACGCGATGGCCAGAACCGCGT
CGTCGGCCAGTTCCAGGTGGTGGACTCCGTGCACTCGCAGACCTTGGACT
GCTCCGGCAAGGACGACACCATCACCCATCTGAGTGCGCAAAAGGGCAAG
CCGCTGACCGGCATCACCTTCGACTGGATTCCGCCAGCAGGCTACAAGGG
CAACGTCAAGTTCATGGCCACCGTGGTGCAGACCGGATTCGTTTACTGGG
TGGGTCGCGTCACAAAAGACATCGATGTGGAGTAGTGCTTGTGATAGATG
TTTTCATGATTTGTTCAAAATCCTACAAGTCTTTGTTTAGCGTTAATGTT
CCGATTAGCTTTGGAGCGTAGTATTTTTGAAAATAAAATCAAAAAGTTCG
TTGAAAAAAAAAAAAAAAA

RE60882.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG7532-RA 753 CG7532-RA 28..686 1..659 3280 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:42:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 14347914..14348445 653..122 2645 99.8 Minus
chr2L 23010047 chr2L 14348508..14348583 128..53 380 100 Minus
chr2L 23010047 chr2L 14350251..14350310 60..1 270 96.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:07:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14349108..14349645 659..122 2675 99.8 Minus
2L 23513712 2L 14349708..14349783 128..53 380 100 Minus
2L 23513712 2L 14351451..14351510 60..1 270 96.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14349108..14349645 659..122 2675 99.8 Minus
2L 23513712 2L 14349708..14349783 128..53 380 100 Minus
2L 23513712 2L 14351451..14351510 60..1 270 96.6 Minus
Blast to na_te.dros performed 2019-03-16 12:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker 7256 Stalker STALKER 7256bp 590..667 107..25 133 66.3 Minus
flea 5034 flea DMBLPP 5034bp Derived from Z27119 (g415797) (Rel. 50, Last updated, Version 6). 905..982 613..536 119 67.9 Minus

RE60882.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:42:41 Download gff for RE60882.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 14347914..14348439 128..653 99 <- Minus
chr2L 14348509..14348582 54..127 100 <- Minus
chr2L 14350258..14350310 1..53 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:28:16 Download gff for RE60882.complete
Subject Subject Range Query Range Percent Splice Strand
CG7532-RA 1..480 56..535 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:54:24 Download gff for RE60882.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)34Fc-RA 1..480 56..535 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:46:50 Download gff for RE60882.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)34Fc-RA 1..480 56..535 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:45:28 Download gff for RE60882.complete
Subject Subject Range Query Range Percent Splice Strand
CG7532-RA 1..480 56..535 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:52:10 Download gff for RE60882.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)34Fc-RA 1..480 56..535 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:09:21 Download gff for RE60882.complete
Subject Subject Range Query Range Percent Splice Strand
CG7532-RA 1..653 1..653 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:54:24 Download gff for RE60882.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)34Fc-RA 1..653 1..653 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:46:50 Download gff for RE60882.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)34Fc-RA 4..656 1..653 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:45:28 Download gff for RE60882.complete
Subject Subject Range Query Range Percent Splice Strand
CG7532-RA 1..653 1..653 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:52:10 Download gff for RE60882.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)34Fc-RA 4..656 1..653 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:42:41 Download gff for RE60882.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14349114..14349639 128..653 100 <- Minus
2L 14349709..14349782 54..127 100 <- Minus
2L 14351458..14351510 1..53 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:42:41 Download gff for RE60882.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14349114..14349639 128..653 100 <- Minus
2L 14349709..14349782 54..127 100 <- Minus
2L 14351458..14351510 1..53 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:42:41 Download gff for RE60882.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14349114..14349639 128..653 100 <- Minus
2L 14349709..14349782 54..127 100 <- Minus
2L 14351458..14351510 1..53 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:46:50 Download gff for RE60882.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14349114..14349639 128..653 100 <- Minus
arm_2L 14349709..14349782 54..127 100 <- Minus
arm_2L 14351458..14351510 1..53 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:16:28 Download gff for RE60882.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14349114..14349639 128..653 100 <- Minus
2L 14349709..14349782 54..127 100 <- Minus
2L 14351458..14351510 1..53 100   Minus

RE60882.hyp Sequence

Translation from 0 to 534

> RE60882.hyp
AHFKFFFSAACVCVFLIDMFRLLVLAACLAISVHAYSDGAPKAACRDLTP
QHGAKLQVTKPPYSISGPSHVRSDQKLTLTLGGDEFLGFMIQARDGQNRV
VGQFQVVDSVHSQTLDCSGKDDTITHLSAQKGKPLTGITFDWIPPAGYKG
NVKFMATVVQTGFVYWVGRVTKDIDVE*

RE60882.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)34Fc-PB 159 CG7532-PB 1..159 19..177 836 100 Plus
l(2)34Fc-PA 159 CG7532-PA 1..159 19..177 836 100 Plus

RE60882.pep Sequence

Translation from 55 to 534

> RE60882.pep
MFRLLVLAACLAISVHAYSDGAPKAACRDLTPQHGAKLQVTKPPYSISGP
SHVRSDQKLTLTLGGDEFLGFMIQARDGQNRVVGQFQVVDSVHSQTLDCS
GKDDTITHLSAQKGKPLTGITFDWIPPAGYKGNVKFMATVVQTGFVYWVG
RVTKDIDVE*

RE60882.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14493-PA 159 GF14493-PA 1..159 1..159 766 88.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10152-PA 159 GG10152-PA 1..159 1..159 763 88.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10402-PA 143 GH10402-PA 1..143 1..159 646 76.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)34Fc-PB 159 CG7532-PB 1..159 1..159 836 100 Plus
l(2)34Fc-PA 159 CG7532-PA 1..159 1..159 836 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17382-PA 159 GI17382-PA 1..159 1..159 741 84.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21051-PA 159 GL21051-PA 1..159 1..159 736 84.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:15:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20419-PA 159 GA20419-PA 1..159 1..159 723 83.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:15:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14866-PA 163 GM14866-PA 5..163 1..159 836 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:15:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22011-PA 163 GD22011-PA 5..163 1..159 836 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:15:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18058-PA 159 GJ18058-PA 1..159 1..159 707 86.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18114-PA 158 GK18114-PA 1..158 1..159 681 79.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25048-PA 159 GE25048-PA 1..159 1..159 828 98.1 Plus