Clone RE60886 Report

Search the DGRC for RE60886

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:608
Well:86
Vector:pFlc-1
Associated Gene/TranscriptCrk-RA
Protein status:RE60886.pep: gold
Sequenced Size:1219

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1587 2004-03-31 Blastp of sequenced clone
Crk 2008-04-29 Release 5.5 accounting
Crk 2008-08-15 Release 5.9 accounting
Crk 2008-12-18 5.12 accounting

Clone Sequence Records

RE60886.complete Sequence

1219 bp (1219 high quality bases) assembled on 2004-03-31

GenBank Submission: BT012456

> RE60886.complete
AAGTGGAAATAATCGATCAAACATTATCGATAGTGTTTCTATGTGTGGCC
CAGCCAGATACACATATAAAAGGCAAATGTTTTAAGGCCAGAAATTCGAA
AATGAAATCACTGAAGAATTCTGGTATATAATAGGCTGTATGCTATATTT
GCATTATATCACATAATTTCTATTTATTTAATCTGGACGGAATTTGTTGT
AATTTGTCTAAGATAAACCTTAAACGGAAATGGATACATTTGACGTTTCT
GATAGGAACAGCTGGTACTTTGGTCCCATGTCTAGACAGGATGCTACTGA
AGTTTTGATGAACGAACGCGAGCGGGGAGTGTTTTTAGTCCGTGATAGTA
ACTCGATAGCAGGGGATTATGTACTTTGTGTAAGAGAAGATACAAAAGTT
AGCAACTACATCATTAACAAAGTTCAACAACAGGATCAAATCGTTTACCG
CATTGGGGATCAGTCTTTTGACAATCTACCGAAACTCTTAACTTTTTACA
CTCTTCATTATTTGGATACAACCCCTTTAAAACGGCCTGCGTGTAGAAGG
GTGGAAAAAGTAATAGGAAAGTTCGATTTCGTTGGCAGCGATCAAGATGA
TTTACCTTTTCAAAGAGGTGAAGTTTTAACAATAGTTCGAAAAGACGAGG
ATCAATGGTGGACTGCGCGTAACTCCTCGGGGAAAATTGGTCAAATACCG
GTTCCCTATATACAACAGTATGACGATTATATGGATGAAGATGCTATTGA
TAAAAACGAACCTTCCATTTCGGGATCTAGCAATGTATTTGAAAGTACTC
TTAAAAGGACAGATTTAAATCGAAAACTACCTGCATACGCCCGCGTAAAA
CAGTCAAGGGTCCCTAACGCATACGATAAGACTGCATTAAAATTGGAAAT
AGGTGACATTATTAAAGTCACTAAAACAAACATTAATGGGCAATGGGAGG
GAGAATTAAATGGAAAAAATGGTCATTTTCCCTTCACGCACGTTGAATTT
GTCGATGATTGTGATTTAAGCAAAAACTCCACAGAAATATGCTAAATAGG
AAGGAATGGAAGGAATTTCTTTTGATAATTTTGATTTTTGAGCTAATTGT
ATGATTAATAAGTTGTGCATACCAATTGTTAACATAATCAGAAAATTAAA
ATCTTATTAAGTAAAATAAAAATAAACGGGTACGAAGGACATAATAAAAA
AAGAAAAAAAAAAAAAAAA

RE60886.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
Crk-RA 1503 Crk-RA 257..1455 1..1199 5995 100 Plus
Crk.g 1375 Crk.g 68..887 1..820 4100 100 Plus
Crk.a 1387 Crk.a 1..719 1..719 3595 100 Plus
Crk.a 1387 Crk.a 859..1339 719..1199 2405 100 Plus
Crk.g 1375 Crk.g 949..1327 821..1199 1895 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:06:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr4 1351717 chr4 233385..233763 821..1199 1895 100 Plus
chr4 1351717 chr4 230820..231080 1..261 1305 100 Plus
chr4 1351717 chr4 232182..232389 383..590 1040 100 Plus
chr4 1351717 chr4 232448..232576 590..718 645 100 Plus
chr4 1351717 chr4 231150..231274 260..384 625 100 Plus
chr4 1351717 chr4 233219..233323 716..820 525 100 Plus
chr4 1351717 chr4 236551..236646 383..478 435 96.9 Plus
chr4 1351717 chr4 236762..236820 590..648 280 98.3 Plus
chr4 1351717 chr4 236645..236705 528..588 275 96.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:07:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:06:11
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 212791..213169 821..1199 1895 100 Plus
4 1348131 4 210226..210486 1..261 1305 100 Plus
4 1348131 4 211588..211795 383..590 1040 100 Plus
4 1348131 4 211854..211982 590..718 645 100 Plus
4 1348131 4 210556..210680 260..384 625 100 Plus
4 1348131 4 212625..212729 716..820 525 100 Plus
4 1348131 4 215957..216052 383..478 435 96.9 Plus
4 1348131 4 216168..216226 590..648 280 98.3 Plus
4 1348131 4 216051..216111 528..588 275 96.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
4 1331231 4 212791..213169 821..1199 1895 100 Plus
4 1331231 4 210226..210486 1..261 1305 100 Plus
4 1331231 4 211588..211795 383..590 1040 100 Plus
4 1331231 4 211854..211982 590..718 645 100 Plus
4 1331231 4 210556..210680 260..384 625 100 Plus
4 1331231 4 212625..212729 716..820 525 100 Plus
4 1331231 4 215957..216052 383..478 435 96.8 Plus
4 1331231 4 216168..216226 590..648 280 98.3 Plus
4 1331231 4 216051..216111 528..588 275 96.7 Plus
Blast to na_te.dros performed 2019-03-15 20:06:11
Subject Length Description Subject Range Query Range Score Percent Strand
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 1553..1607 1119..1060 118 70 Minus

RE60886.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:07:05 Download gff for RE60886.complete
Subject Subject Range Query Range Percent Splice Strand
chr4 230820..231080 1..261 100 -> Plus
chr4 231152..231274 262..384 100 -> Plus
chr4 232184..232388 385..589 100 -> Plus
chr4 232448..232576 590..718 100 -> Plus
chr4 233222..233323 719..820 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:28:17 Download gff for RE60886.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RA 1..816 230..1045 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:48:07 Download gff for RE60886.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RA 1..816 230..1045 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:02:40 Download gff for RE60886.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RC 1..816 230..1045 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:29:18 Download gff for RE60886.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RA 1..816 230..1045 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:28:23 Download gff for RE60886.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RC 1..816 230..1045 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:57:51 Download gff for RE60886.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RA 1..1129 70..1198 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:48:07 Download gff for RE60886.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RA 1..1195 1..1195 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:02:40 Download gff for RE60886.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RA 3..1197 1..1195 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:29:18 Download gff for RE60886.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RA 1..1129 70..1198 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:28:23 Download gff for RE60886.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RA 3..1197 1..1195 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:07:05 Download gff for RE60886.complete
Subject Subject Range Query Range Percent Splice Strand
4 210558..210680 262..384 100 -> Plus
4 211590..211794 385..589 100 -> Plus
4 211854..211982 590..718 100 -> Plus
4 212628..212729 719..820 100 -> Plus
4 210226..210486 1..261 100 -> Plus
4 212791..213169 821..1203 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:07:05 Download gff for RE60886.complete
Subject Subject Range Query Range Percent Splice Strand
4 210558..210680 262..384 100 -> Plus
4 211590..211794 385..589 100 -> Plus
4 211854..211982 590..718 100 -> Plus
4 212628..212729 719..820 100 -> Plus
4 210226..210486 1..261 100 -> Plus
4 212791..213169 821..1203 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:07:05 Download gff for RE60886.complete
Subject Subject Range Query Range Percent Splice Strand
4 210558..210680 262..384 100 -> Plus
4 211590..211794 385..589 100 -> Plus
4 211854..211982 590..718 100 -> Plus
4 212628..212729 719..820 100 -> Plus
4 210226..210486 1..261 100 -> Plus
4 212791..213169 821..1203 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:02:40 Download gff for RE60886.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 230852..231112 1..261 100 -> Plus
arm_4 231184..231306 262..384 100 -> Plus
arm_4 232216..232420 385..589 100 -> Plus
arm_4 232480..232608 590..718 100 -> Plus
arm_4 233254..233355 719..820 100 -> Plus
arm_4 233417..233795 821..1203 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:06:40 Download gff for RE60886.complete
Subject Subject Range Query Range Percent Splice Strand
4 211590..211794 385..589 100 -> Plus
4 211854..211982 590..718 100 -> Plus
4 212628..212729 719..820 100 -> Plus
4 210226..210486 1..261 100 -> Plus
4 210558..210680 262..384 100 -> Plus
4 212791..213169 821..1203 98   Plus

RE60886.hyp Sequence

Translation from 229 to 1044

> RE60886.hyp
MDTFDVSDRNSWYFGPMSRQDATEVLMNERERGVFLVRDSNSIAGDYVLC
VREDTKVSNYIINKVQQQDQIVYRIGDQSFDNLPKLLTFYTLHYLDTTPL
KRPACRRVEKVIGKFDFVGSDQDDLPFQRGEVLTIVRKDEDQWWTARNSS
GKIGQIPVPYIQQYDDYMDEDAIDKNEPSISGSSNVFESTLKRTDLNRKL
PAYARVKQSRVPNAYDKTALKLEIGDIIKVTKTNINGQWEGELNGKNGHF
PFTHVEFVDDCDLSKNSTEIC*

RE60886.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
Crk-PA 271 CG1587-PA 1..271 1..271 1436 100 Plus
Crk-PC 271 CG1587-PC 1..271 1..271 1436 100 Plus
Crk-PE 263 CG1587-PE 1..263 1..271 1367 97 Plus
Crk-PB 253 CG1587-PB 1..253 1..271 1318 93.4 Plus
Crk-PD 184 CG1587-PD 1..168 1..168 864 97 Plus

RE60886.pep Sequence

Translation from 229 to 1044

> RE60886.pep
MDTFDVSDRNSWYFGPMSRQDATEVLMNERERGVFLVRDSNSIAGDYVLC
VREDTKVSNYIINKVQQQDQIVYRIGDQSFDNLPKLLTFYTLHYLDTTPL
KRPACRRVEKVIGKFDFVGSDQDDLPFQRGEVLTIVRKDEDQWWTARNSS
GKIGQIPVPYIQQYDDYMDEDAIDKNEPSISGSSNVFESTLKRTDLNRKL
PAYARVKQSRVPNAYDKTALKLEIGDIIKVTKTNINGQWEGELNGKNGHF
PFTHVEFVDDCDLSKNSTEIC*

RE60886.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23415-PA 342 GF23415-PA 1..256 1..261 1113 79.3 Plus
Dana\GF11180-PA 211 GF11180-PA 60..209 12..164 163 28.1 Plus
Dana\GF14287-PA 938 GF14287-PA 240..322 10..90 147 40.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16379-PA 269 GG16379-PA 1..268 1..270 1376 95.6 Plus
Dere\GG22486-PA 211 GG22486-PA 60..209 12..164 163 28.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23941-PA 277 GH23941-PA 1..267 1..266 1230 84.7 Plus
Dgri\GH22624-PA 211 GH22624-PA 58..209 10..164 163 27.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
Crk-PA 271 CG1587-PA 1..271 1..271 1436 100 Plus
Crk-PC 271 CG1587-PC 1..271 1..271 1436 100 Plus
Crk-PE 263 CG1587-PE 1..263 1..271 1367 97 Plus
Crk-PB 253 CG1587-PB 1..253 1..271 1318 93.4 Plus
Crk-PD 184 CG1587-PD 1..168 1..168 864 97 Plus
Crk-PH 64 CG1587-PH 1..52 1..52 274 100 Plus
Crk-PG 84 CG1587-PG 1..51 1..51 269 100 Plus
drk-PD 211 CG6033-PD 58..209 10..164 171 27.8 Plus
drk-PF 211 CG6033-PF 58..209 10..164 171 27.8 Plus
drk-PA 211 CG6033-PA 58..209 10..164 171 27.8 Plus
drk-PB 211 CG6033-PB 58..209 10..164 171 27.8 Plus
drk-PC 211 CG6033-PC 58..209 10..164 171 27.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14066-PA 293 GI14066-PA 1..279 1..271 1179 79.5 Plus
Dmoj\GI21333-PA 211 GI21333-PA 60..209 12..164 160 27.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18154-PA 297 GL18154-PA 1..285 1..270 1244 82.1 Plus
Dper\GL17069-PA 211 GL17069-PA 60..209 12..164 164 28.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:44:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13993-PA 297 GA13993-PA 1..285 1..270 1244 82.1 Plus
Dpse\GA19310-PA 211 GA19310-PA 60..209 12..164 164 28.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:44:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23242-PA 271 GM23242-PA 1..270 1..270 1441 100 Plus
Dsec\GM20273-PA 211 GM20273-PA 60..209 12..164 164 28.1 Plus
Dsec\GM17975-PA 870 GM17975-PA 238..330 10..100 149 35.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:44:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14194-PA 108 GD14194-PA 1..107 164..270 567 100 Plus
Dsim\drk-PA 182 GD25755-PA 29..180 10..164 162 27.8 Plus
Dsim\GD22611-PA 944 GD22611-PA 238..320 10..90 147 37.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:44:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18986-PA 298 GJ18986-PA 1..283 1..264 1205 80.6 Plus
Dvir\GJ19679-PA 211 GJ19679-PA 58..209 10..164 163 27.8 Plus
Dvir\GJ12514-PA 952 GJ12514-PA 237..319 10..90 148 37.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13611-PA 280 GK13611-PA 1..267 1..270 1248 85.9 Plus
Dwil\GK10660-PA 211 GK10660-PA 58..209 10..164 163 27.8 Plus
Dwil\GK15403-PA 969 GK15403-PA 248..330 10..90 147 37.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:44:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14540-PA 271 GE14540-PA 1..270 1..270 1428 98.9 Plus
Dyak\GE13357-PA 211 GE13357-PA 58..209 10..164 163 27.8 Plus