Clone RE61190 Report

Search the DGRC for RE61190

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:611
Well:90
Vector:pFlc-1
Associated Gene/TranscriptCG10311-RA
Protein status:RE61190.pep: gold
Preliminary Size:719
Sequenced Size:977

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10311 2002-01-01 Sim4 clustering to Release 2
CG10311 2002-04-26 Blastp of sequenced clone
CG10311 2003-01-01 Sim4 clustering to Release 3
CG10311 2008-04-29 Release 5.5 accounting
CG10311 2008-08-15 Release 5.9 accounting
CG10311 2008-12-18 5.12 accounting

Clone Sequence Records

RE61190.complete Sequence

977 bp (977 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113535

> RE61190.complete
AGTCGCTCCGTGAAACCCGTCGCACTCACATCGAAATCGCGCGCAAGTCG
TCGGATCCAAATCGCCTCGAAACGCTACGCACTTGGAGGAGGCAAATATC
AAATATATGAGAATAATTAGTTAGGAGGCAGCCGAATCAGCGGAATCAAA
TCGATTTCCCTCGACTGCATTTAGCAGTGCTGCACCATCAAATCAAAAAT
AAATTAGAAAGTCTGGTAATCACAATATAGATTTGCCAAAATGCCGAAGC
CACTGTTAAATTCGTGCTGTCTGTGCCAATCGACCCGGAATGGCTCCGTT
ATCTCGGGCATACTGGCGATAGTCCTGTCGATCATCACCATCGTGGTGAT
CTTCACGACGCGGGTGCACTTCAAGACGATAATCTTTGACTTCATCCCCA
ATGACATTGTTAAGATAATTCTAGTCATCAATTTGTGCATGACGATCTTG
ATATCGCTGCTCATGATCATTGGTGCCCTGAAGCGGAACCACTACCTGAT
GGTTCCATGGGTGGTCCTCGGCATTATGATTGCCATCGGTCTGCTGATCT
CCGTCATCTACACGGGCATCGTCTTCTTCATCGACGGCTACGTGCTGACG
GGAGTCCTCTGGCTGATCTTCGGCCTAATTGTCTGCGCGATTATGACCTA
TTGCTGGTGCGTGGTCTATAGTGAATACGCCAACCTGTCCGAGGAGAACG
AGCGCGGTCGTTACAACAAGCAGCCGTACCGTCGCTAGAATCTCCAGGAG
CACTATTCATCAGAAATTGCATTCAAGAAGCTGAATCCACCACCCACACA
TCTTCATCCTAGCTTCCTATGTTCGTTTTTAGTGATTATGTCTAACTAAT
AATTATAATTTAGTTGAGGCGAGCCAGCCCTTCGCTCACATCGAATTTAC
GCGGCCCGTGGCATTAAGTGCAATGGAATTATGTATTTAACATTTAAATA
AAACTTTAATCCAAAAAAAAAAAAAAA

RE61190.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG10311.a 1556 CG10311.a 466..1428 1..963 4815 100 Plus
CG10311-RA 1305 CG10311-RA 215..1177 1..963 4815 100 Plus
nc_17179.a 702 nc_17179.a 15..97 83..1 415 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12175602..12175927 962..637 1615 99.7 Minus
chr3R 27901430 chr3R 12176786..12177044 483..225 1295 100 Minus
chr3R 27901430 chr3R 12181491..12181702 212..1 1045 99.5 Minus
chr3R 27901430 chr3R 12176575..12176730 637..482 780 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:07:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16350905..16351231 963..637 1635 100 Minus
3R 32079331 3R 16352089..16352359 483..213 1355 100 Minus
3R 32079331 3R 16356800..16357011 212..1 1060 100 Minus
3R 32079331 3R 16351878..16352033 637..482 780 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16091736..16092062 963..637 1635 100 Minus
3R 31820162 3R 16092920..16093190 483..213 1355 100 Minus
3R 31820162 3R 16097631..16097842 212..1 1060 100 Minus
3R 31820162 3R 16092709..16092864 637..482 780 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:28:53 has no hits.

RE61190.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:29:48 Download gff for RE61190.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12175602..12175926 638..962 99 <- Minus
chr3R 12176575..12176728 484..637 100 <- Minus
chr3R 12176786..12177052 220..483 98 <- Minus
chr3R 12181487..12181702 1..219 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:28:24 Download gff for RE61190.complete
Subject Subject Range Query Range Percent Splice Strand
CG10311-RA 1..498 241..738 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:50 Download gff for RE61190.complete
Subject Subject Range Query Range Percent Splice Strand
CG10311-RA 1..498 241..738 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:29:37 Download gff for RE61190.complete
Subject Subject Range Query Range Percent Splice Strand
CG10311-RA 1..498 241..738 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:44:27 Download gff for RE61190.complete
Subject Subject Range Query Range Percent Splice Strand
CG10311-RA 1..498 241..738 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:33:24 Download gff for RE61190.complete
Subject Subject Range Query Range Percent Splice Strand
CG10311-RA 1..498 241..738 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:29:48 Download gff for RE61190.complete
Subject Subject Range Query Range Percent Splice Strand
CG10311-RA 1..962 1..962 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:50 Download gff for RE61190.complete
Subject Subject Range Query Range Percent Splice Strand
CG10311-RA 1..962 1..962 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:29:37 Download gff for RE61190.complete
Subject Subject Range Query Range Percent Splice Strand
CG10311-RA 5..966 1..962 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:44:27 Download gff for RE61190.complete
Subject Subject Range Query Range Percent Splice Strand
CG10311-RA 1..962 1..962 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:33:24 Download gff for RE61190.complete
Subject Subject Range Query Range Percent Splice Strand
CG10311-RA 5..966 1..962 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:48 Download gff for RE61190.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16350906..16351230 638..962 100 <- Minus
3R 16351878..16352031 484..637 100 <- Minus
3R 16352089..16352359 213..483 100 <- Minus
3R 16356800..16357011 1..212 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:48 Download gff for RE61190.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16350906..16351230 638..962 100 <- Minus
3R 16351878..16352031 484..637 100 <- Minus
3R 16352089..16352359 213..483 100 <- Minus
3R 16356800..16357011 1..212 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:48 Download gff for RE61190.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16350906..16351230 638..962 100 <- Minus
3R 16351878..16352031 484..637 100 <- Minus
3R 16352089..16352359 213..483 100 <- Minus
3R 16356800..16357011 1..212 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:29:37 Download gff for RE61190.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12182522..12182733 1..212 100   Minus
arm_3R 12176628..12176952 638..962 100 <- Minus
arm_3R 12177600..12177753 484..637 100 <- Minus
arm_3R 12177811..12178081 213..483 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:48 Download gff for RE61190.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16091737..16092061 638..962 100 <- Minus
3R 16092709..16092862 484..637 100 <- Minus
3R 16092920..16093190 213..483 100 <- Minus
3R 16097631..16097842 1..212 100   Minus

RE61190.pep Sequence

Translation from 240 to 737

> RE61190.pep
MPKPLLNSCCLCQSTRNGSVISGILAIVLSIITIVVIFTTRVHFKTIIFD
FIPNDIVKIILVINLCMTILISLLMIIGALKRNHYLMVPWVVLGIMIAIG
LLISVIYTGIVFFIDGYVLTGVLWLIFGLIVCAIMTYCWCVVYSEYANLS
EENERGRYNKQPYRR*

RE61190.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16523-PA 165 GF16523-PA 1..165 1..165 792 92.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20037-PA 165 GG20037-PA 1..165 1..165 829 98.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14526-PA 165 GH14526-PA 1..165 1..165 794 90.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG10311-PB 165 CG10311-PB 1..165 1..165 852 100 Plus
CG10311-PA 165 CG10311-PA 1..165 1..165 852 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24648-PA 165 GI24648-PA 1..165 1..165 724 87.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22247-PA 165 GL22247-PA 1..165 1..165 803 93.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10238-PA 165 GA10238-PA 1..165 1..165 803 93.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15442-PA 165 GM15442-PA 1..165 1..165 826 98.2 Plus
Dsec\GM19763-PA 72 GM19763-PA 1..46 96..141 171 84.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20297-PA 165 GD20297-PA 1..165 1..165 833 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23470-PA 165 GJ23470-PA 1..165 1..165 748 91.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13509-PA 165 GK13509-PA 1..165 1..165 786 90.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26321-PA 165 GE26321-PA 1..165 1..165 838 100 Plus

RE61190.hyp Sequence

Translation from 240 to 737

> RE61190.hyp
MPKPLLNSCCLCQSTRNGSVISGILAIVLSIITIVVIFTTRVHFKTIIFD
FIPNDIVKIILVINLCMTILISLLMIIGALKRNHYLMVPWVVLGIMIAIG
LLISVIYTGIVFFIDGYVLTGVLWLIFGLIVCAIMTYCWCVVYSEYANLS
EENERGRYNKQPYRR*

RE61190.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG10311-PB 165 CG10311-PB 1..165 1..165 852 100 Plus
CG10311-PA 165 CG10311-PA 1..165 1..165 852 100 Plus