Clone RE61257 Report

Search the DGRC for RE61257

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:612
Well:57
Vector:pFlc-1
Associated Gene/TranscriptCG13738-RA
Protein status:RE61257.pep: gold
Preliminary Size:282
Sequenced Size:367

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13738 2002-01-01 Sim4 clustering to Release 2
CG13738 2002-04-26 Blastp of sequenced clone
CG13738 2003-01-01 Sim4 clustering to Release 3
CG13738 2008-04-29 Release 5.5 accounting
CG13738 2008-08-15 Release 5.9 accounting
CG13738 2008-12-18 5.12 accounting

Clone Sequence Records

RE61257.complete Sequence

367 bp (367 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113536

> RE61257.complete
ATTAACTGCTGGATCATATAGAGAATATCAACGATGAAGTACTTTGTGAT
CTGTGTTTTGGCTGCAATCGTTCTTTTCCAGTCCGCATCGGGATTCAAGC
GGCGAGTGATCTATGTGGTACCAGCACCCACAACGAGTACAACGACCACA
ACAACAACAACAACGGCGGCACCATCGAGCTCCGCCACGACGACCACCAA
CGCTCCTGAGGTGGTTTACCAGGTGGTCTACTGTTCCTGGAAGAACAACT
GGTGTCGTCCCGTCTCGAACACCGTGAGAAATTGCAAGTGGGGCTTCTGC
AAGTTCAATGGATAAAAGTCAATAAAAACAAGCTTTGATAATGTTTAGCA
CAAAAAAAAAAAAAAAA

RE61257.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG13738-RA 354 CG13738-RA 1..354 1..354 1755 99.7 Plus
CG13738.a 342 CG13738.a 70..342 82..354 1365 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13963178..13963525 351..1 1645 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:07:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13973120..13973473 354..1 1755 99.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13966220..13966573 354..1 1755 99.7 Minus
Blast to na_te.dros performed on 2019-03-15 14:27:36 has no hits.

RE61257.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:28:37 Download gff for RE61257.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13963178..13963525 1..351 91   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:28:26 Download gff for RE61257.complete
Subject Subject Range Query Range Percent Splice Strand
CG13738-RA 1..282 34..315 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:02:57 Download gff for RE61257.complete
Subject Subject Range Query Range Percent Splice Strand
CG13738-RA 1..282 34..315 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:29:17 Download gff for RE61257.complete
Subject Subject Range Query Range Percent Splice Strand
CG13738-RA 1..282 34..315 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:03:15 Download gff for RE61257.complete
Subject Subject Range Query Range Percent Splice Strand
CG13738-RA 1..282 34..315 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:58:58 Download gff for RE61257.complete
Subject Subject Range Query Range Percent Splice Strand
CG13738-RA 1..282 34..315 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:28:14 Download gff for RE61257.complete
Subject Subject Range Query Range Percent Splice Strand
CG13738-RA 1..351 1..351 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:02:57 Download gff for RE61257.complete
Subject Subject Range Query Range Percent Splice Strand
CG13738-RA 1..351 1..351 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:29:17 Download gff for RE61257.complete
Subject Subject Range Query Range Percent Splice Strand
CG13738-RA 5..355 1..351 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:03:15 Download gff for RE61257.complete
Subject Subject Range Query Range Percent Splice Strand
CG13738-RA 1..351 1..351 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:58:58 Download gff for RE61257.complete
Subject Subject Range Query Range Percent Splice Strand
CG13738-RA 5..355 1..351 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:28:37 Download gff for RE61257.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13973123..13973473 1..351 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:28:37 Download gff for RE61257.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13973123..13973473 1..351 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:28:37 Download gff for RE61257.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13973123..13973473 1..351 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:29:17 Download gff for RE61257.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13966223..13966573 1..351 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:24 Download gff for RE61257.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13966223..13966573 1..351 99   Minus

RE61257.pep Sequence

Translation from 33 to 314

> RE61257.pep
MKYFVICVLAAIVLFQSASGFKRRVIYVVPAPTTSTTTTTTTTTAAPSSS
ATTTTNAPEVVYQVVYCSWKNNWCRPVSNTVRNCKWGFCKFNG*

RE61257.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:24:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10402-PA 90 GF10402-PA 1..90 1..93 213 55.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:24:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13745-PA 104 GG13745-PA 1..104 1..93 336 65.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13738-PA 93 CG13738-PA 1..93 1..93 502 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12495-PA 89 GA12495-PA 1..89 1..93 261 59.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24570-PA 84 GM24570-PA 1..84 1..93 299 71 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:25:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12642-PA 90 GD12642-PA 1..90 1..93 308 72 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20042-PA 97 GE20042-PA 1..97 1..93 253 70.1 Plus

RE61257.hyp Sequence

Translation from 33 to 314

> RE61257.hyp
MKYFVICVLAAIVLFQSASGFKRRVIYVVPAPTTSTTTTTTTTTAAPSSS
ATTTTNAPEVVYQVVYCSWKNNWCRPVSNTVRNCKWGFCKFNG*

RE61257.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG13738-PA 93 CG13738-PA 1..93 1..93 502 100 Plus