RE61257.complete Sequence
367 bp (367 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113536
> RE61257.complete
ATTAACTGCTGGATCATATAGAGAATATCAACGATGAAGTACTTTGTGAT
CTGTGTTTTGGCTGCAATCGTTCTTTTCCAGTCCGCATCGGGATTCAAGC
GGCGAGTGATCTATGTGGTACCAGCACCCACAACGAGTACAACGACCACA
ACAACAACAACAACGGCGGCACCATCGAGCTCCGCCACGACGACCACCAA
CGCTCCTGAGGTGGTTTACCAGGTGGTCTACTGTTCCTGGAAGAACAACT
GGTGTCGTCCCGTCTCGAACACCGTGAGAAATTGCAAGTGGGGCTTCTGC
AAGTTCAATGGATAAAAGTCAATAAAAACAAGCTTTGATAATGTTTAGCA
CAAAAAAAAAAAAAAAA
RE61257.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:03:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13738-RA | 354 | CG13738-RA | 1..354 | 1..354 | 1755 | 99.7 | Plus |
CG13738.a | 342 | CG13738.a | 70..342 | 82..354 | 1365 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:27:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 13963178..13963525 | 351..1 | 1645 | 98.6 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:07:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:27:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 13973120..13973473 | 354..1 | 1755 | 99.7 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 13966220..13966573 | 354..1 | 1755 | 99.7 | Minus |
Blast to na_te.dros performed on 2019-03-15 14:27:36 has no hits.
RE61257.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:28:37 Download gff for
RE61257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 13963178..13963525 | 1..351 | 91 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:28:26 Download gff for
RE61257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13738-RA | 1..282 | 34..315 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:02:57 Download gff for
RE61257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13738-RA | 1..282 | 34..315 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:29:17 Download gff for
RE61257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13738-RA | 1..282 | 34..315 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:03:15 Download gff for
RE61257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13738-RA | 1..282 | 34..315 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:58:58 Download gff for
RE61257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13738-RA | 1..282 | 34..315 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:28:14 Download gff for
RE61257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13738-RA | 1..351 | 1..351 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:02:57 Download gff for
RE61257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13738-RA | 1..351 | 1..351 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:29:17 Download gff for
RE61257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13738-RA | 5..355 | 1..351 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:03:15 Download gff for
RE61257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13738-RA | 1..351 | 1..351 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:58:58 Download gff for
RE61257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13738-RA | 5..355 | 1..351 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:28:37 Download gff for
RE61257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13973123..13973473 | 1..351 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:28:37 Download gff for
RE61257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13973123..13973473 | 1..351 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:28:37 Download gff for
RE61257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13973123..13973473 | 1..351 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:29:17 Download gff for
RE61257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 13966223..13966573 | 1..351 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:24 Download gff for
RE61257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13966223..13966573 | 1..351 | 99 | | Minus |
RE61257.pep Sequence
Translation from 33 to 314
> RE61257.pep
MKYFVICVLAAIVLFQSASGFKRRVIYVVPAPTTSTTTTTTTTTAAPSSS
ATTTTNAPEVVYQVVYCSWKNNWCRPVSNTVRNCKWGFCKFNG*
RE61257.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:24:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF10402-PA | 90 | GF10402-PA | 1..90 | 1..93 | 213 | 55.3 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:24:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG13745-PA | 104 | GG13745-PA | 1..104 | 1..93 | 336 | 65.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13738-PA | 93 | CG13738-PA | 1..93 | 1..93 | 502 | 100 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:25:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA12495-PA | 89 | GA12495-PA | 1..89 | 1..93 | 261 | 59.6 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:25:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM24570-PA | 84 | GM24570-PA | 1..84 | 1..93 | 299 | 71 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:25:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD12642-PA | 90 | GD12642-PA | 1..90 | 1..93 | 308 | 72 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:25:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE20042-PA | 97 | GE20042-PA | 1..97 | 1..93 | 253 | 70.1 | Plus |
RE61257.hyp Sequence
Translation from 33 to 314
> RE61257.hyp
MKYFVICVLAAIVLFQSASGFKRRVIYVVPAPTTSTTTTTTTTTAAPSSS
ATTTTNAPEVVYQVVYCSWKNNWCRPVSNTVRNCKWGFCKFNG*
RE61257.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:43:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13738-PA | 93 | CG13738-PA | 1..93 | 1..93 | 502 | 100 | Plus |