Clone RE61341 Report

Search the DGRC for RE61341

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:613
Well:41
Vector:pFlc-1
Associated Gene/TranscriptSmG-RA
Protein status:RE61341.pep: gold
Sequenced Size:494

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9742 2002-01-01 Sim4 clustering to Release 2
CG9742 2003-01-01 Sim4 clustering to Release 3
SmG 2008-04-29 Release 5.5 accounting
SmG 2008-08-15 Release 5.9 accounting
SmG 2008-12-18 5.12 accounting

Clone Sequence Records

RE61341.complete Sequence

494 bp (494 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113538

> RE61341.complete
AGTCAATAGTGACATCTCTAGCTTGCGGTCCGCGTTTTTACTTAATTTTC
CCATTTTGCGCAAATTAAACCATCAAAATGTCGAAGGCCCATCCCCCAGA
GGTGAAAAAATACATGGACAAGCGCATGATGCTGAAACTGAACGGCGGAC
GCGCGGTGACCGGTATTTTGCGAGGCTTCGATCCCTTCATGAACGTGGTC
CTGGACGACACGGTGGAGGAGTGCAAGGACAACACGAAGAACAACATCGG
CATGGTGGTTATCCGCGGCAACAGCATCGTCATGGTGGAGGCCCTGGACA
GGGTCTAGCACCCGCCTCGGAACCCGATCTCGTCGAGCATCGTTAGCCGT
AGTGCTTAGTCTTAAGGCTCCGTAACATTCATAGTCAGAAGAAACACACA
AACTCTTGAATAAATTCTATAACAAAGATACCCCTTTTTGAACTGACAAT
TTATATGAGCAGTTTGGAAAATAAGTCGAAAAAAAAAAAAAAAA

RE61341.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
SmG-RB 569 SmG-RB 82..561 3..482 2400 100 Plus
SmG-RA 569 SmG-RA 82..561 3..482 2400 100 Plus
SmG.a 497 SmG.a 14..490 3..482 2330 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16529478..16529699 478..257 1110 100 Minus
chrX 22417052 chrX 16529759..16529908 259..110 750 100 Minus
chrX 22417052 chrX 16529974..16530080 109..3 535 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:07:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16639806..16640031 482..257 1130 100 Minus
X 23542271 X 16640091..16640240 259..110 750 100 Minus
X 23542271 X 16640306..16640412 109..3 535 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16647904..16648129 482..257 1130 100 Minus
X 23527363 X 16648189..16648338 259..110 750 100 Minus
X 23527363 X 16648404..16648510 109..3 535 100 Minus
Blast to na_te.dros performed on 2019-03-16 12:42:47 has no hits.

RE61341.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:44:10 Download gff for RE61341.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16529974..16530081 1..109 99   Minus
chrX 16529478..16529698 258..478 100 <- Minus
chrX 16529761..16529908 110..257 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:28:31 Download gff for RE61341.complete
Subject Subject Range Query Range Percent Splice Strand
SmG-RB 1..231 78..308 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:55:05 Download gff for RE61341.complete
Subject Subject Range Query Range Percent Splice Strand
SmG-RB 1..231 78..308 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:47:27 Download gff for RE61341.complete
Subject Subject Range Query Range Percent Splice Strand
SmG-RA 1..231 78..308 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:47:34 Download gff for RE61341.complete
Subject Subject Range Query Range Percent Splice Strand
SmG-RB 1..231 78..308 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:52:19 Download gff for RE61341.complete
Subject Subject Range Query Range Percent Splice Strand
SmG-RA 1..231 78..308 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:34:09 Download gff for RE61341.complete
Subject Subject Range Query Range Percent Splice Strand
SmG-RA 2..477 3..478 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:55:04 Download gff for RE61341.complete
Subject Subject Range Query Range Percent Splice Strand
SmG-RA 2..477 3..478 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:47:27 Download gff for RE61341.complete
Subject Subject Range Query Range Percent Splice Strand
SmG-RA 6..483 1..478 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:47:34 Download gff for RE61341.complete
Subject Subject Range Query Range Percent Splice Strand
SmG-RA 2..477 3..478 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:52:19 Download gff for RE61341.complete
Subject Subject Range Query Range Percent Splice Strand
SmG-RA 6..483 1..478 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:44:10 Download gff for RE61341.complete
Subject Subject Range Query Range Percent Splice Strand
X 16639810..16640030 258..478 100 <- Minus
X 16640093..16640240 110..257 100 <- Minus
X 16640306..16640413 1..109 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:44:10 Download gff for RE61341.complete
Subject Subject Range Query Range Percent Splice Strand
X 16639810..16640030 258..478 100 <- Minus
X 16640093..16640240 110..257 100 <- Minus
X 16640306..16640413 1..109 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:44:10 Download gff for RE61341.complete
Subject Subject Range Query Range Percent Splice Strand
X 16639810..16640030 258..478 100 <- Minus
X 16640093..16640240 110..257 100 <- Minus
X 16640306..16640413 1..109 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:47:27 Download gff for RE61341.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16533843..16534063 258..478 100 <- Minus
arm_X 16534126..16534273 110..257 100 <- Minus
arm_X 16534339..16534446 1..109 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:20:12 Download gff for RE61341.complete
Subject Subject Range Query Range Percent Splice Strand
X 16647908..16648128 258..478 100 <- Minus
X 16648191..16648338 110..257 100 <- Minus
X 16648404..16648511 1..109 99   Minus

RE61341.hyp Sequence

Translation from 0 to 345

> RE61341.hyp
INSDISSLRSAFLLNFPILRKLNHQNVEGPSPRGEKIHGQAHDAETERRT
RGDRYFARLRSLHERGPGRHGGGVQGQHEEQHRHGGYPRQQHRHGGGPGQ
GLAPASEPDLVEHR*
Sequence RE61341.hyp has no blast hits.

RE61341.pep Sequence

Translation from 77 to 307

> RE61341.pep
MSKAHPPEVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECK
DNTKNNIGMVVIRGNSIVMVEALDRV*

RE61341.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:31:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21254-PA 101 GF21254-PA 26..101 1..76 389 98.7 Plus
Dana\GF14546-PA 110 GF14546-PA 23..100 8..76 144 35.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:31:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18240-PA 76 GG18240-PA 1..76 1..76 388 98.7 Plus
Dere\GG20109-PA 110 GG20109-PA 23..100 8..76 142 35.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:31:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12097-PA 76 GH12097-PA 1..76 1..76 384 96.1 Plus
Dgri\GH10206-PA 113 GH10206-PA 23..100 8..76 144 35.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
SNRPG-PB 76 CG9742-PB 1..76 1..76 391 100 Plus
SNRPG-PA 76 CG9742-PA 1..76 1..76 391 100 Plus
LSm7-PB 110 CG13277-PB 23..100 8..76 142 35.9 Plus
LSm7-PC 110 CG13277-PC 23..100 8..76 142 35.9 Plus
LSm7-PA 110 CG13277-PA 23..100 8..76 142 35.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:31:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11102-PA 76 GI11102-PA 1..76 1..76 385 97.4 Plus
Dmoj\GI14941-PA 110 GI14941-PA 23..100 8..76 144 35.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:31:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24044-PA 76 GL24044-PA 1..76 1..76 377 93.4 Plus
Dper\GL19334-PA 110 GL19334-PA 23..100 8..76 145 35.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:31:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26490-PA 76 GA26490-PA 1..76 1..76 377 93.4 Plus
Dpse\GA12164-PA 110 GA12164-PA 23..100 8..76 145 35.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:31:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13382-PA 76 GM13382-PA 1..76 1..76 391 100 Plus
Dsec\GM17159-PA 110 GM17159-PA 23..100 8..76 142 35.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15738-PA 76 GD15738-PA 1..76 1..76 391 100 Plus
Dsim\GD21898-PA 110 GD21898-PA 23..100 8..76 142 35.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15956-PA 76 GJ15956-PA 1..76 1..76 385 97.4 Plus
Dvir\GJ24083-PA 110 GJ24083-PA 23..100 8..76 144 35.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:31:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25208-PA 76 GK25208-PA 1..76 1..76 381 96.1 Plus
Dwil\GK18159-PA 110 GK18159-PA 23..100 8..76 144 35.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:31:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15956-PA 76 GE15956-PA 1..76 1..76 388 98.7 Plus
Dyak\GE13166-PA 110 GE13166-PA 23..100 8..76 142 35.9 Plus