Clone RE61442 Report

Search the DGRC for RE61442

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:614
Well:42
Vector:pFlc-1
Associated Gene/TranscriptTrf-RA
Protein status:RE61442.pep: gold
Preliminary Size:944
Sequenced Size:1007

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7562 2002-01-01 Sim4 clustering to Release 2
CG7562 2002-06-14 Blastp of sequenced clone
CG7562 2003-01-01 Sim4 clustering to Release 3
Trf 2008-04-29 Release 5.5 accounting
Trf 2008-08-15 Release 5.9 accounting
Trf 2008-12-18 5.12 accounting

Clone Sequence Records

RE61442.complete Sequence

1007 bp (1007 high quality bases) assembled on 2002-06-14

GenBank Submission: AY128483

> RE61442.complete
ATACAATTTTCGTCAGCAATAAAATAGGACAACACTGGCCACGTCGCGTG
CGGATTTGTTTATAATTTTCGGCAATGCAGTTTCACTTTAAAGTCGCGGA
CGCTGAAAGGGACAGGGATAATGTGGCTGCGACCAGCAATGCTGCCGCCA
ATCCGCACGCAGCCCTGCAGCCGCAACAGCCCGTTGCCCTGGTGGAGCCC
AAGGATGCACAACATGAGATACGATTGCAGAATATCGTGGCCACCTTCTC
GGTGAACTGTGAACTGGACCTCAAGGCAATCAACTCGCGTACGAGGAACT
CGGAGTACTCGCCCAAGCGCTTTCGTGGCGTCATCATGCGAATGCACTCG
CCCAGGTGCACAGCGCTAATCTTTCGAACGGGCAAGGTCATCTGCACGGG
TGCACGAAACGAGATTGAGGCGGACATTGGATCGCGAAAGTTCGCACGCA
TCCTGCAGAAGCTGGGATTCCCCGTAAAGTTCATGGAATACAAGCTGCAG
AATATTGTGGCCACCGTTGATCTGCGCTTCCCCATCCGCCTGGAGAACCT
CAACCACGTGCACGGGCAGTTTAGTTCCTACGAACCGGAGATGTTTCCAG
GCCTAATCTATCGCATGGTCAAGCCGCGCATCGTTCTCCTGATCTTCGTC
AACGGAAAGGTTGTATTTACGGGCGCCAAGTCGCGCAAGGACATTATGGA
CTGCCTGGAGGCGATATCACCTATTTTACTAAGTTTTCGCAAGACGTAGT
TGTTTCTACACATCCAAATGTTTTTGTTTAGCTTAGTTATATTCCATAAC
TACAATATTTTTAATATATTTACCTTAACTTTTTTAGTATAAAATGTGAA
ATGAAACAACTTAATTAATAATTTCCATGGGTAAATTCATAGAAATTGTA
AGATTTTATTTTGGCCTTACTAAGCAAATTAATTTTTATTTAAAAAAAAC
TGTTGTTATTTTAAATAAATTTTTATATATTAATGTCTTGCAAAAAAAAA
AAAAAAA

RE61442.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
Trf-RA 1023 Trf-RA 34..1023 1..990 4950 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8072185..8072945 230..990 3805 100 Plus
chr2L 23010047 chr2L 8071885..8072114 1..230 1150 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:07:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8073197..8073957 230..990 3805 100 Plus
2L 23513712 2L 8072897..8073126 1..230 1150 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:13:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8073197..8073957 230..990 3805 100 Plus
2L 23513712 2L 8072897..8073126 1..230 1150 100 Plus
Blast to na_te.dros performed 2019-03-16 02:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
TAHRE 10463 TAHRE OSV 10463bp 44..93 922..972 126 76.9 Plus

RE61442.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:50:55 Download gff for RE61442.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8071885..8072113 1..229 100 -> Plus
chr2L 8072185..8072945 230..991 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:28:35 Download gff for RE61442.complete
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 1..675 75..749 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:50:49 Download gff for RE61442.complete
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 1..675 75..749 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:23:28 Download gff for RE61442.complete
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 1..675 75..749 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:33:01 Download gff for RE61442.complete
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 1..675 75..749 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:23:15 Download gff for RE61442.complete
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 1..675 75..749 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:01:50 Download gff for RE61442.complete
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 1..982 1..982 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:50:49 Download gff for RE61442.complete
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 1..982 1..982 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:23:28 Download gff for RE61442.complete
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 3..983 1..981 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:33:01 Download gff for RE61442.complete
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 1..982 1..982 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:23:15 Download gff for RE61442.complete
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 3..983 1..981 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:50:55 Download gff for RE61442.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8072897..8073125 1..229 100 -> Plus
2L 8073197..8073957 230..991 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:50:55 Download gff for RE61442.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8072897..8073125 1..229 100 -> Plus
2L 8073197..8073957 230..991 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:50:55 Download gff for RE61442.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8072897..8073125 1..229 100 -> Plus
2L 8073197..8073957 230..991 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:28 Download gff for RE61442.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8072897..8073125 1..229 100 -> Plus
arm_2L 8073197..8073957 230..991 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:13:32 Download gff for RE61442.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8072897..8073125 1..229 100 -> Plus
2L 8073197..8073957 230..991 99   Plus

RE61442.pep Sequence

Translation from 74 to 748

> RE61442.pep
MQFHFKVADAERDRDNVAATSNAAANPHAALQPQQPVALVEPKDAQHEIR
LQNIVATFSVNCELDLKAINSRTRNSEYSPKRFRGVIMRMHSPRCTALIF
RTGKVICTGARNEIEADIGSRKFARILQKLGFPVKFMEYKLQNIVATVDL
RFPIRLENLNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTG
AKSRKDIMDCLEAISPILLSFRKT*

RE61442.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14757-PA 224 GF14757-PA 1..224 1..224 1104 93.8 Plus
Dana\GF11627-PA 348 GF11627-PA 147..346 26..223 606 56.5 Plus
Dana\GF21727-PA 1683 GF21727-PA 1242..1415 48..223 337 37.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10512-PA 224 GG10512-PA 1..224 1..224 1180 98.2 Plus
Dere\GG20753-PA 349 GG20753-PA 144..347 22..223 612 55.9 Plus
Dere\GG18249-PA 641 GG18249-PA 194..391 34..223 336 35.3 Plus
Dere\GG24500-PA 251 GG24500-PA 56..215 62..222 157 25.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11614-PA 220 GH11614-PA 1..220 1..224 1038 86.6 Plus
Dgri\GH23121-PA 348 GH23121-PA 142..346 21..223 609 55.1 Plus
Dgri\GH10255-PA 314 GH10255-PA 11..195 37..222 352 36.7 Plus
Dgri\GH11849-PA 689 GH11849-PA 197..384 36..223 347 36.6 Plus
Dgri\GH23390-PA 259 GH23390-PA 53..219 55..222 180 28.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
Trf-PA 224 CG7562-PA 1..224 1..224 1146 100 Plus
Tbp-PA 353 CG9874-PA 148..351 22..223 586 55.9 Plus
Trf2-PJ 632 CG18009-PJ 157..376 1..223 331 33.8 Plus
Trf2-PH 632 CG18009-PH 157..376 1..223 331 33.8 Plus
Trf2-PI 1714 CG18009-PI 1239..1458 1..223 331 33.8 Plus
Trf2-PE 1715 CG18009-PE 1240..1459 1..223 331 33.8 Plus
Trf2-PF 1715 CG18009-PF 1240..1459 1..223 331 33.8 Plus
Trf2-PG 1715 CG18009-PG 1240..1459 1..223 331 33.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17918-PA 220 GI17918-PA 1..220 1..224 1047 87.1 Plus
Dmoj\GI18943-PA 348 GI18943-PA 139..346 18..223 608 54.8 Plus
Dmoj\GI14331-PA 656 GI14331-PA 256..435 44..223 344 38.3 Plus
Dmoj\GI15474-PA 442 GI15474-PA 87..262 45..222 338 36.3 Plus
Dmoj\GI22955-PA 315 GI22955-PA 117..278 60..222 154 23.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24756-PA 220 GL24756-PA 1..220 1..224 1058 88.4 Plus
Dper\GL11271-PA 345 GL11271-PA 129..343 10..223 617 54.2 Plus
Dper\GL16412-PA 987 GL16412-PA 496..673 44..223 349 38.1 Plus
Dper\GL23716-PA 640 GL23716-PA 200..410 24..223 308 32.7 Plus
Dper\GL26452-PA 240 GL26452-PA 45..203 62..222 151 27.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20441-PA 220 GA20441-PA 1..220 1..224 1058 88.4 Plus
Dpse\GA22088-PA 345 GA22088-PA 129..343 10..223 617 54.2 Plus
Dpse\GA14764-PA 1037 GA14764-PA 547..724 44..223 349 38.1 Plus
Dpse\GA26713-PA 642 GA26713-PA 200..410 24..223 311 31.8 Plus
Dpse\GA13701-PA 240 GA13701-PA 45..203 62..222 151 27.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16720-PA 224 GM16720-PA 1..224 1..224 1178 98.7 Plus
Dsec\GM15696-PA 352 GM15696-PA 147..350 22..223 611 55.9 Plus
Dsec\GM21561-PA 278 GM21561-PA 4..171 56..223 308 37.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23502-PA 224 GD23502-PA 1..224 1..224 1183 99.1 Plus
Dsim\GD25175-PA 352 GD25175-PA 147..350 22..223 612 55.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17690-PA 220 GJ17690-PA 1..220 1..224 1039 86.6 Plus
Dvir\GJ14917-PA 352 GJ14917-PA 142..350 18..223 611 55 Plus
Dvir\Tbp-PA 351 GJ21317-PA 149..349 25..223 609 56.2 Plus
Dvir\GJ19385-PA 711 GJ19385-PA 272..452 43..223 347 38 Plus
Dvir\GJ17285-PA 387 GJ17285-PA 14..223 16..222 333 36 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15318-PA 226 GK15318-PA 1..226 1..224 1061 90.3 Plus
Dwil\GK10649-PA 351 GK10649-PA 135..349 11..223 622 54.4 Plus
Dwil\GK16294-PA 1222 GK16294-PA 726..904 40..223 345 37.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18732-PA 224 GE18732-PA 1..224 1..224 1173 97.8 Plus
Dyak\GE13685-PA 349 GE13685-PA 144..347 22..223 612 55.9 Plus
Dyak\GE15780-PA 1872 GE15780-PA 1417..1617 32..223 314 33.8 Plus

RE61442.hyp Sequence

Translation from 74 to 748

> RE61442.hyp
MQFHFKVADAERDRDNVAATSNAAANPHAALQPQQPVALVEPKDAQHEIR
LQNIVATFSVNCELDLKAINSRTRNSEYSPKRFRGVIMRMHSPRCTALIF
RTGKVICTGARNEIEADIGSRKFARILQKLGFPVKFMEYKLQNIVATVDL
RFPIRLENLNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTG
AKSRKDIMDCLEAISPILLSFRKT*

RE61442.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
Trf-PA 224 CG7562-PA 1..224 1..224 1146 100 Plus
Tbp-PA 353 CG9874-PA 148..351 22..223 586 55.9 Plus
Trf2-PJ 632 CG18009-PJ 157..376 1..223 331 33.8 Plus
Trf2-PH 632 CG18009-PH 157..376 1..223 331 33.8 Plus
Trf2-PI 1714 CG18009-PI 1239..1458 1..223 331 33.8 Plus