Clone RE61564 Report

Search the DGRC for RE61564

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:615
Well:64
Vector:pFlc-1
Associated Gene/TranscriptCG11777-RA
Protein status:RE61564.pep: gold
Preliminary Size:507
Sequenced Size:716

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11777 2002-01-01 Sim4 clustering to Release 2
CG11777 2002-04-26 Blastp of sequenced clone
CG11777 2003-01-01 Sim4 clustering to Release 3
CG11777 2008-04-29 Release 5.5 accounting
CG11777 2008-08-15 Release 5.9 accounting
CG11777 2008-12-18 5.12 accounting

Clone Sequence Records

RE61564.complete Sequence

716 bp (716 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113541

> RE61564.complete
ACAATCACTTTTAAAATGTCTGTAACGCTGCACACCGACGTGGGTGACCT
CAAAATAGAGCTCTTCTGCGATGCCTGCCCCAAGGCCTGCGAAAATTTCC
TCGCCCTGTGTGCGAGCGACTATTACAGCGGCTGCGTCTTCATCCGAAAC
ATCAAGGGATTTATTGTCCAAACTGGAGATCCTACGAACACCGGAAAGAA
TGGACAGTCCATTTGGGGCCAGAAGTTCGACGACGAATTCAAGGAGACCA
TTAAGCACACTGATCGAGGAATGGTTTCCATGGCCAACAACGGACCGAAC
GCCAATGCCAGCCAGTTCTTCATTACCTATGCCGCCCAGCCAAATCTTGA
CTTGAAGTACACGCTCTTTGGCCGTGTGATCGATGGATTCGATGCCCTGG
ATGAACTGGAGAAACTGCCCGTCAATCCCAAGAACTATCGTCCCCATGTG
GACAAGAAGATCAATGGAGTAACTATACATGCCAATCCTTTGGCGACGTG
ATAGAGATAGAGACAAAGGCCAATCGTACGCTTAAAATGAAATATATTTA
TAGCACTTAAGGTTACGCGATTTCTTCGATTACAGACTAATTGATTGAGA
AACATCAAATATTGTGCAAAAGTATCTAAAGACTAAATCTTAAAACCAGC
CAAGTCACAATTGTTTATAAAAAATTGCATTGTTTATGTATAACTCTCAC
AAAAAAAAAAAAAAAA

RE61564.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG11777-RA 751 CG11777-RA 52..751 1..700 3500 100 Plus
CPTI-RB 2997 CPTI-RB 2781..2997 700..484 1085 100 Minus
CPTI-RD 3003 CPTI-RD 2787..3003 700..484 1085 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6356743..6357189 254..700 2235 100 Plus
chr2R 21145070 chr2R 6356244..6356481 18..255 1160 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:08:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10469199..10469645 254..700 2235 100 Plus
2R 25286936 2R 10468700..10468937 18..255 1190 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10470398..10470844 254..700 2235 100 Plus
2R 25260384 2R 10469899..10470136 18..255 1190 100 Plus
Blast to na_te.dros performed 2019-03-16 08:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
aurora-element 4263 aurora-element DMAURA 4263bp Derived from AB022762 (d1268008) (Rel. 59, Last updated, Version 1). 3324..3387 451..513 110 65.6 Plus

RE61564.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:47:46 Download gff for RE61564.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6356245..6356481 19..255 99 -> Plus
chr2R 6356163..6356180 1..18 100 -> Plus
chr2R 6356745..6357189 256..700 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:28:37 Download gff for RE61564.complete
Subject Subject Range Query Range Percent Splice Strand
CG11777-RA 1..486 16..501 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:55:09 Download gff for RE61564.complete
Subject Subject Range Query Range Percent Splice Strand
CG11777-RA 1..486 16..501 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:57:08 Download gff for RE61564.complete
Subject Subject Range Query Range Percent Splice Strand
CG11777-RA 1..486 16..501 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:47:37 Download gff for RE61564.complete
Subject Subject Range Query Range Percent Splice Strand
CG11777-RA 1..486 16..501 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:50:38 Download gff for RE61564.complete
Subject Subject Range Query Range Percent Splice Strand
CG11777-RA 1..486 16..501 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:34:15 Download gff for RE61564.complete
Subject Subject Range Query Range Percent Splice Strand
CG11777-RA 1..700 1..700 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:55:08 Download gff for RE61564.complete
Subject Subject Range Query Range Percent Splice Strand
CG11777-RA 20..717 1..698 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:57:08 Download gff for RE61564.complete
Subject Subject Range Query Range Percent Splice Strand
CG11777-RA 4..701 1..698 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:47:38 Download gff for RE61564.complete
Subject Subject Range Query Range Percent Splice Strand
CG11777-RA 1..700 1..700 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:50:38 Download gff for RE61564.complete
Subject Subject Range Query Range Percent Splice Strand
CG11777-RA 4..701 1..698 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:47:46 Download gff for RE61564.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10468619..10468636 1..18 100 -> Plus
2R 10468701..10468937 19..255 100 -> Plus
2R 10469201..10469645 256..700 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:47:46 Download gff for RE61564.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10468619..10468636 1..18 100 -> Plus
2R 10468701..10468937 19..255 100 -> Plus
2R 10469201..10469645 256..700 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:47:46 Download gff for RE61564.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10468619..10468636 1..18 100 -> Plus
2R 10468701..10468937 19..255 100 -> Plus
2R 10469201..10469645 256..700 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:57:08 Download gff for RE61564.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6356124..6356141 1..18 100 -> Plus
arm_2R 6356206..6356442 19..255 100 -> Plus
arm_2R 6356706..6357150 256..700 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:20:16 Download gff for RE61564.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10469900..10470136 19..255 100 -> Plus
2R 10470400..10470844 256..700 100   Plus
2R 10469818..10469835 1..18 100 -> Plus

RE61564.hyp Sequence

Translation from 0 to 500

> RE61564.hyp
TITFKMSVTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRN
IKGFIVQTGDPTNTGKNGQSIWGQKFDDEFKETIKHTDRGMVSMANNGPN
ANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDELEKLPVNPKNYRPHV
DKKINGVTIHANPLAT*

RE61564.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG11777-PA 161 CG11777-PA 1..161 6..166 868 100 Plus
CG7747-PA 517 CG7747-PA 282..438 8..165 438 50.6 Plus
CG3511-PB 637 CG3511-PB 483..634 7..160 365 49.4 Plus
CG3511-PA 637 CG3511-PA 483..634 7..160 365 49.4 Plus
Cypl-PA 176 CG13892-PA 23..162 8..148 319 44.7 Plus

RE61564.pep Sequence

Translation from 15 to 500

> RE61564.pep
MSVTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFI
VQTGDPTNTGKNGQSIWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQ
FFITYAAQPNLDLKYTLFGRVIDGFDALDELEKLPVNPKNYRPHVDKKIN
GVTIHANPLAT*

RE61564.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13766-PA 161 GF13766-PA 1..160 1..160 861 100 Plus
Dana\GF11272-PA 517 GF11272-PA 282..438 3..160 437 50 Plus
Dana\GF25290-PA 496 GF25290-PA 15..171 3..159 344 45.6 Plus
Dana\GF25039-PA 175 GF25039-PA 22..161 3..143 332 45.4 Plus
Dana\GF13630-PA 639 GF13630-PA 485..636 2..155 316 49.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24170-PA 161 GG24170-PA 1..161 1..161 863 99.4 Plus
Dere\GG22278-PA 517 GG22278-PA 282..438 3..160 443 51.3 Plus
Dere\GG15530-PA 502 GG15530-PA 15..171 3..159 341 45.6 Plus
Dere\GG14657-PA 176 GG14657-PA 23..162 3..143 331 44.7 Plus
Dere\GG22984-PA 637 GG22984-PA 484..634 3..155 316 49.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:52:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21257-PA 161 GH21257-PA 1..160 1..160 836 96.2 Plus
Dgri\GH19751-PA 513 GH19751-PA 281..436 3..159 413 47.8 Plus
Dgri\GH15083-PA 499 GH15083-PA 15..170 3..158 358 46.8 Plus
Dgri\GH21768-PA 173 GH21768-PA 20..159 3..143 325 44 Plus
Dgri\GH20004-PA 637 GH20004-PA 483..634 2..155 317 49.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG11777-PA 161 CG11777-PA 1..161 1..161 868 100 Plus
CG7747-PA 517 CG7747-PA 282..438 3..160 438 50.6 Plus
CG3511-PB 637 CG3511-PB 483..634 2..155 365 49.4 Plus
CG3511-PA 637 CG3511-PA 483..634 2..155 365 49.4 Plus
CG10907-PA 502 CG10907-PA 15..133 3..121 333 52.9 Plus
Cypl-PA 176 CG13892-PA 23..162 3..143 319 44.7 Plus
CG5808-PA 653 CG5808-PA 1..165 1..158 270 38.6 Plus
Moca-cyp-PA 970 CG1866-PA 26..176 9..149 262 42.5 Plus
CG17266-PB 183 CG17266-PB 28..169 7..140 253 40.6 Plus
CG17266-PA 183 CG17266-PA 28..169 7..140 253 40.6 Plus
Cyp1-PA 227 CG9916-PA 80..206 9..132 252 45.3 Plus
CG7768-PB 164 CG7768-PB 17..143 9..132 248 45.3 Plus
CG7768-PA 164 CG7768-PA 17..143 9..132 248 45.3 Plus
cyp33-PA 300 CG4886-PA 151..279 8..133 238 43.1 Plus
CG8336-PD 383 CG8336-PD 27..163 8..133 227 42 Plus
CG8336-PC 383 CG8336-PC 27..163 8..133 227 42 Plus
CG8336-PA 383 CG8336-PA 27..163 8..133 227 42 Plus
CG8336-PB 383 CG8336-PB 27..163 8..133 227 42 Plus
CG2852-PD 205 CG2852-PD 43..181 10..146 212 38.7 Plus
CG2852-PA 205 CG2852-PA 43..181 10..146 212 38.7 Plus
ninaA-PA 237 CG3966-PA 40..178 9..141 194 34.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:52:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19335-PA 180 GI19335-PA 20..179 1..160 845 96.9 Plus
Dmoj\GI20287-PA 517 GI20287-PA 281..436 3..159 420 48.4 Plus
Dmoj\GI13730-PA 507 GI13730-PA 15..171 3..159 354 46.2 Plus
Dmoj\GI22699-PA 173 GI22699-PA 20..159 3..143 326 44 Plus
Dmoj\GI19185-PA 643 GI19185-PA 489..640 2..155 317 49.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:52:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17294-PA 161 GL17294-PA 1..161 1..161 842 96.3 Plus
Dper\GL11352-PA 517 GL11352-PA 282..438 3..160 441 51.9 Plus
Dper\GL20720-PA 503 GL20720-PA 15..133 3..121 354 54.6 Plus
Dper\GL22598-PA 175 GL22598-PA 22..161 3..143 332 45.4 Plus
Dper\GL10223-PA 636 GL10223-PA 482..633 2..155 319 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:52:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11192-PA 162 GA11192-PA 3..162 2..161 840 96.9 Plus
Dpse\GA20560-PA 517 GA20560-PA 282..438 3..160 441 51.9 Plus
Dpse\GA10630-PA 503 GA10630-PA 15..133 3..121 354 54.6 Plus
Dpse\GA12606-PA 175 GA12606-PA 22..161 3..143 332 45.4 Plus
Dpse\GA17492-PA 636 GA17492-PA 482..633 2..155 319 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:52:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21220-PA 161 GM21220-PA 1..161 1..161 865 100 Plus
Dsec\GM20066-PA 517 GM20066-PA 282..438 3..160 439 50.6 Plus
Dsec\GM25298-PA 502 GM25298-PA 15..171 3..159 341 45.6 Plus
Dsec\GM14273-PA 176 GM14273-PA 23..162 3..143 331 44.7 Plus
Dsec\GM11877-PA 637 GM11877-PA 484..634 3..155 315 49.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:52:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10743-PA 161 GD10743-PA 1..161 1..161 865 100 Plus
Dsim\GD14329-PA 502 GD14329-PA 15..171 3..159 342 45.6 Plus
Dsim\GD25702-PA 176 GD25702-PA 23..162 3..143 331 44.7 Plus
Dsim\GD11875-PA 637 GD11875-PA 484..634 3..155 315 49.7 Plus
Dsim\GD21371-PA 1003 GD21371-PA 26..176 9..149 274 43.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:52:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22213-PA 182 GJ22213-PA 23..181 2..160 837 97.5 Plus
Dvir\GJ15535-PA 281 GJ15535-PA 45..200 3..159 423 48.4 Plus
Dvir\GJ22016-PA 517 GJ22016-PA 281..436 3..159 421 48.4 Plus
Dvir\GJ14076-PA 498 GJ14076-PA 15..171 3..159 351 45.6 Plus
Dvir\GJ23427-PA 173 GJ23427-PA 20..159 3..143 327 44.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18005-PA 171 GK18005-PA 12..170 2..160 846 98.7 Plus
Dwil\GK20914-PA 520 GK20914-PA 282..438 3..160 423 50 Plus
Dwil\GK24526-PA 508 GK24526-PA 15..171 3..159 338 45.6 Plus
Dwil\GK20536-PA 174 GK20536-PA 21..160 3..143 330 44 Plus
Dwil\GK12669-PA 639 GK12669-PA 485..636 2..155 315 49.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19364-PA 161 GE19364-PA 1..161 1..161 865 100 Plus
Dyak\GE14073-PA 517 GE14073-PA 282..438 3..160 439 50.6 Plus
Dyak\GE21848-PA 502 GE21848-PA 15..171 3..159 348 46.2 Plus
Dyak\GE21017-PA 176 GE21017-PA 23..162 3..143 331 44.7 Plus
Dyak\GE14421-PA 637 GE14421-PA 484..634 3..155 315 49.7 Plus