Clone RE61749 Report

Search the DGRC for RE61749

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:617
Well:49
Vector:pFlc-1
Associated Gene/TranscriptCG14667-RA
Protein status:RE61749.pep: wuzgold
Preliminary Size:972
Sequenced Size:1286

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14667 2002-01-01 Sim4 clustering to Release 2
CG14667 2002-04-26 Blastp of sequenced clone
CG14667 2003-01-01 Sim4 clustering to Release 3
CG14667 2008-04-29 Release 5.5 accounting
CG14667 2008-08-15 Release 5.9 accounting
CG14667 2008-12-18 5.12 accounting
CG14667 2011-03-01 Transcript Validation

Clone Sequence Records

RE61749.complete Sequence

1286 bp (1286 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113543

> RE61749.complete
AAGTTGATAAACAATGAACCTCGCCGACGTTTGCCGTATTTGCGCCAACA
AAATTATGGGCCACCAGCGAGATCGCAACATATTCATTCACATGCGGGGA
AAATATTTGGGTCAACTGAAGCTAATCACGGGAGTGGAGCTGACAAGAAA
CCAGGGGCTGCCGGAGATTGTTTGCGAGCGCTGCTTCTCCGAGCTGGACC
TGGCCACCAAGTTCCGCGAGCGGTGCATCTTCTCGCAAAAGTACCTGCTG
GATATCATAAAGAAGACCAGTGATCAAAGCACTGTTCACGTTGAGCTTAG
TTCCGAGCCGCTGGACGAGCAACTGATCGATGCGGATCAATTGGAGACGC
ACTACGATGACGACCAGTACGTTTGTTATCAAGGCACGAAAGAGGAACAC
CAAGACCTAGAGGAAATCGAGCTGGATGACGACCCCTCTGCCGCTGTGAT
AGCGGCAGCAGAGGCGGCAGCAGAAGCGGCGCAGCAGGAGGATCTACAGG
AGCAGGAAATGGAGCGGGCCGCCAAGAGGCGCAGTAACTTCTTTATCTGC
GACGAGTGTGGAACCCTGTTCCACGATGCGTTCCTGTACACCGAGCATTT
AAATGGGCACCAGAACCGGCGGGATATGAACCAGTTCTTCCCCTGCCCTG
AGTGCCCACAGACTTTTAACAAGAAGGCGCTTCTCAAGCAGCATCGCACC
CAGGTTCATTTAATTAACCGCAGGTTCCAGTGCACCATCTGCCACGAGGC
TTTCGCGTCTCTGGGCGCTAAGTTGCGGCACGACAAGTAAGGAGGCTGGG
AATTGAATGCTAGCGCAGCACTATATGCAACTTCCAATTTCATTTTAGAG
CCCATAAGAACGAACGACCTTATCCATGCCTAGAATGCGGAATGATCTTC
AGCAGCGTTTCCGAATTGCAGAACCACTTTTCGACACACTCAAAGCAAAT
CCGAAAGTTCAGGTGTGAGCCTTGCAACATGGATTTTATAACTCGCCGAG
GCTTGGTGGCCCATACAAAAACAGCACCGCATAAGCGCCTTGCCAAATAT
ATGCAGGATGAATTCGATTTCATCGAATTGGCAACCTAACCCTCAATTAT
TACCACCTTCTTTCTAAGTAAATGCTAAGGTCAAAAAAGTAAATCATAAT
TGAGTAGTTCAGTTTACTACTTCGCTACCATAATATTCGACAATGGAGTA
TCGGTTCAATGTTATTTTTTTATAAGTGTATTTTTAATTTATTGAAAATA
AAATTCCTTCAGTTTTAAAGAAAAAAAAAAAAAAAA

RE61749.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG14667-RA 1364 CG14667-RA 75..1338 4..1267 6305 99.9 Plus
CG14667.a 1357 CG14667.a 74..856 4..786 3915 100 Plus
CG14667-RB 1403 CG14667-RB 86..868 4..786 3915 100 Plus
CG14667-RB 1403 CG14667-RB 869..1287 849..1267 2080 99.7 Plus
CG14667.a 1357 CG14667.a 1021..1331 957..1267 1525 99.3 Plus
CG14667.a 1357 CG14667.a 857..972 849..964 580 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:48:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1200935..1201761 138..964 4135 100 Plus
chr3R 27901430 chr3R 1201810..1202120 957..1267 1525 99.4 Plus
chr3R 27901430 chr3R 1200740..1200875 4..139 680 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:08:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5375276..5376102 138..964 4135 100 Plus
3R 32079331 3R 5376151..5376461 957..1267 1525 99.4 Plus
3R 32079331 3R 5375081..5375216 4..139 680 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5116107..5116933 138..964 4135 100 Plus
3R 31820162 3R 5116982..5117292 957..1267 1525 99.3 Plus
3R 31820162 3R 5115912..5116047 4..139 680 100 Plus
Blast to na_te.dros performed 2019-03-16 08:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
hopper 1435 hopper DMTRDNA 1435bp Derived from X80025 (g510507) (Rel. 44, Last updated, Version 11). 168..220 1205..1258 132 74.1 Plus
McClintock 6450 McClintock McCLINTOCK 6450bp 1094..1151 1266..1205 129 72.6 Minus

RE61749.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:49:05 Download gff for RE61749.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1201816..1202061 963..1208 99 <- Plus
chr3R 1200937..1201247 140..450 100 == Plus
chr3R 1200737..1200875 1..139 99 -> Plus
chr3R 1201303..1201759 506..962 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:28:41 Download gff for RE61749.complete
Subject Subject Range Query Range Percent Splice Strand
CG14667-RA 1..777 14..790 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:55:11 Download gff for RE61749.complete
Subject Subject Range Query Range Percent Splice Strand
CG14667-RA 1..777 14..790 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:57:12 Download gff for RE61749.complete
Subject Subject Range Query Range Percent Splice Strand
CG14667-RA 1..777 14..790 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:47:47 Download gff for RE61749.complete
Subject Subject Range Query Range Percent Splice Strand
CG14667-RA 1..777 14..790 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:51:10 Download gff for RE61749.complete
Subject Subject Range Query Range Percent Splice Strand
CG14667-RB 1..773 14..786 100 == Plus
CG14667-RB 774..1014 849..1089 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:34:18 Download gff for RE61749.complete
Subject Subject Range Query Range Percent Splice Strand
CG14667-RA 9..1275 1..1267 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:55:11 Download gff for RE61749.complete
Subject Subject Range Query Range Percent Splice Strand
CG14667-RA 9..1275 1..1267 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:57:12 Download gff for RE61749.complete
Subject Subject Range Query Range Percent Splice Strand
CG14667-RA 9..1275 1..1267 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:47:48 Download gff for RE61749.complete
Subject Subject Range Query Range Percent Splice Strand
CG14667-RA 9..1275 1..1267 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:51:10 Download gff for RE61749.complete
Subject Subject Range Query Range Percent Splice Strand
CG14667-RB 57..842 1..786 99 == Plus
CG14667-RB 843..1260 849..1266 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:49:05 Download gff for RE61749.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5375078..5375216 1..139 99 -> Plus
3R 5375278..5376100 140..962 100 -> Plus
3R 5376157..5376461 963..1270 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:49:05 Download gff for RE61749.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5375078..5375216 1..139 99 -> Plus
3R 5375278..5376100 140..962 100 -> Plus
3R 5376157..5376461 963..1270 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:49:05 Download gff for RE61749.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5375078..5375216 1..139 99 -> Plus
3R 5375278..5376100 140..962 100 -> Plus
3R 5376157..5376461 963..1270 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:57:12 Download gff for RE61749.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1200800..1200938 1..139 99 -> Plus
arm_3R 1201000..1201822 140..962 100 -> Plus
arm_3R 1201879..1202183 963..1270 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:20:19 Download gff for RE61749.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5116109..5116931 140..962 100 -> Plus
3R 5116988..5117292 963..1270 98   Plus
3R 5115909..5116047 1..139 99 -> Plus

RE61749.pep Sequence

Translation from 13 to 789

> RE61749.pep
MNLADVCRICANKIMGHQRDRNIFIHMRGKYLGQLKLITGVELTRNQGLP
EIVCERCFSELDLATKFRERCIFSQKYLLDIIKKTSDQSTVHVELSSEPL
DEQLIDADQLETHYDDDQYVCYQGTKEEHQDLEEIELDDDPSAAVIAAAE
AAAEAAQQEDLQEQEMERAAKRRSNFFICDECGTLFHDAFLYTEHLNGHQ
NRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASL
GAKLRHDK*

RE61749.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17249-PA 320 GF17249-PA 1..242 1..258 594 53.9 Plus
Dana\GF22028-PA 370 GF22028-PA 6..202 7..240 187 27 Plus
Dana\GF18185-PA 317 GF18185-PA 2..250 3..258 185 26.6 Plus
Dana\GF18255-PA 627 GF18255-PA 183..477 7..257 181 23 Plus
Dana\GF18186-PA 409 GF18186-PA 4..277 5..258 176 25.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12782-PA 334 GG12782-PA 1..253 1..258 1032 75.2 Plus
Dere\GG12737-PA 394 GG12737-PA 2..268 3..258 200 24.7 Plus
Dere\GG18034-PA 334 GG18034-PA 4..264 3..258 169 24.4 Plus
Dere\GG17430-PA 347 GG17430-PA 3..271 4..258 159 22.1 Plus
Dere\GG17429-PA 418 GG17429-PA 8..327 2..258 158 22.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17845-PA 350 GH17845-PA 7..265 2..257 443 41.1 Plus
Dgri\GH18577-PA 386 GH18577-PA 2..276 3..258 174 24.6 Plus
Dgri\GH22380-PA 579 GH22380-PA 186..442 5..255 170 24.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG14667-PB 337 CG14667-PB 1..258 1..258 1372 100 Plus
CG8159-PB 399 CG8159-PB 2..268 3..258 224 24.9 Plus
M1BP-PA 418 CG9797-PA 8..327 2..258 210 23.3 Plus
ranshi-PA 346 CG9793-PA 5..272 6..258 198 23.7 Plus
CG31441-PA 341 CG31441-PA 4..271 3..258 191 22.5 Plus
ouib-PA 312 CG11762-PA 5..243 6..258 187 25.1 Plus
CG6813-PD 256 CG6813-PD 6..220 7..258 184 24.6 Plus
CG6813-PB 256 CG6813-PB 6..220 7..258 184 24.6 Plus
CG6813-PC 294 CG6813-PC 6..220 7..258 184 24.6 Plus
CG1792-PA 372 CG1792-PA 6..272 7..258 182 24.2 Plus
Odj-PA 430 CG7357-PA 5..283 7..258 181 24.1 Plus
CG4854-PA 319 CG4854-PA 12..254 7..258 149 20.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22549-PA 338 GI22549-PA 3..256 2..258 511 45.9 Plus
Dmoj\GI22394-PA 371 GI22394-PA 2..269 3..258 193 25.4 Plus
Dmoj\GI22393-PA 359 GI22393-PA 2..281 3..258 172 24.4 Plus
Dmoj\GI23401-PA 372 GI23401-PA 1..288 3..258 152 24.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21642-PA 328 GL21642-PA 1..247 1..258 647 51.5 Plus
Dper\GL21707-PA 294 GL21707-PA 5..209 6..258 206 27.3 Plus
Dper\GL12478-PA 401 GL12478-PA 2..269 3..258 205 25.6 Plus
Dper\GL12613-PA 364 GL12613-PA 5..271 7..258 196 24.4 Plus
Dper\GL12476-PA 333 GL12476-PA 2..260 3..258 189 24.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26357-PB 247 GA26357-PB 1..247 1..258 651 52.5 Plus
Dpse\GA26357-PA 328 GA26357-PA 1..247 1..258 650 52.5 Plus
Dpse\GA19878-PB 294 GA19878-PB 5..209 6..258 209 26.1 Plus
Dpse\GA19878-PA 251 GA19878-PA 5..207 6..256 208 26.3 Plus
Dpse\GA20857-PA 401 GA20857-PA 2..269 3..258 206 25.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10804-PA 339 GM10804-PA 1..258 1..258 1145 88 Plus
Dsec\GM23759-PA 399 GM23759-PA 2..268 3..258 204 25.5 Plus
Dsec\GM26088-PA 256 GM26088-PA 6..215 7..253 183 24.7 Plus
Dsec\GM26322-PA 346 GM26322-PA 1..267 6..258 162 24.8 Plus
Dsec\GM15334-PA 321 GM15334-PA 10..246 7..258 159 23 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19784-PA 339 GD19784-PA 1..258 1..258 1150 88.8 Plus
Dsim\GD18570-PA 399 GD18570-PA 2..268 3..258 203 24.5 Plus
Dsim\GD20849-PA 397 GD20849-PA 52..318 6..258 178 26.3 Plus
Dsim\GD18569-PA 312 GD18569-PA 2..243 3..258 163 23.9 Plus
Dsim\GD20207-PA 427 GD20207-PA 1..280 3..258 150 23.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11107-PA 344 GJ11107-PA 7..263 2..258 519 43.7 Plus
Dvir\GJ22679-PA 375 GJ22679-PA 2..277 3..258 228 25.8 Plus
Dvir\GJ10170-PA 332 GJ10170-PA 8..245 1..258 158 24.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:54:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11848-PA 340 GK11848-PA 1..262 1..258 473 44.2 Plus
Dwil\GK11276-PA 396 GK11276-PA 2..299 3..258 164 22.7 Plus
Dwil\GK13271-PA 363 GK13271-PA 1..287 3..258 163 22.6 Plus
Dwil\GK12137-PA 319 GK12137-PA 1..237 3..258 162 25.3 Plus
Dwil\GK14008-PA 675 GK14008-PA 204..487 7..258 162 21.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:54:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25465-PA 336 GE25465-PA 1..255 1..258 957 73.4 Plus
Dyak\GE25903-PA 398 GE25903-PA 2..268 3..258 195 24.6 Plus
Dyak\GE25902-PA 306 GE25902-PA 2..232 3..258 172 24.6 Plus
Dyak\GE24830-PA 418 GE24830-PA 8..327 2..258 164 22.7 Plus
Dyak\GE25242-PA 436 GE25242-PA 5..290 7..258 162 23.1 Plus

RE61749.hyp Sequence

Translation from 13 to 789

> RE61749.hyp
MNLADVCRICANKIMGHQRDRNIFIHMRGKYLGQLKLITGVELTRNQGLP
EIVCERCFSELDLATKFRERCIFSQKYLLDIIKKTSDQSTVHVELSSEPL
DEQLIDADQLETHYDDDQYVCYQGTKEEHQDLEEIELDDDPSAAVIAAAE
AAAEAAQQEDLQEQEMERAAKRRSNFFICDECGTLFHDAFLYTEHLNGHQ
NRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASL
GAKLRHDK*

RE61749.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG14667-PB 337 CG14667-PB 1..258 1..258 1372 100 Plus
CG8159-PB 399 CG8159-PB 2..268 3..258 224 24.9 Plus
M1BP-PA 418 CG9797-PA 8..327 2..258 210 23.3 Plus
ranshi-PA 346 CG9793-PA 5..272 6..258 198 23.7 Plus
CG11762-PA 312 CG11762-PA 5..243 6..258 187 25.1 Plus