Clone RE61805 Report

Search the DGRC for RE61805

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:618
Well:5
Vector:pFlc-1
Associated Gene/TranscriptCG11699-RA
Protein status:RE61805.pep: gold
Preliminary Size:829
Sequenced Size:654

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11699 2001-12-14 Blastp of sequenced clone
CG11699 2002-01-01 Sim4 clustering to Release 2
CG11699 2003-01-01 Sim4 clustering to Release 3
CG11699 2008-04-29 Release 5.5 accounting
CG11699 2008-08-15 Release 5.9 accounting
CG11699 2008-12-18 5.12 accounting

Clone Sequence Records

RE61805.complete Sequence

654 bp (654 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071552

> RE61805.complete
TCAAGAGCGGTCAAGCAATCAGCTGTGTTGTGCGATCCAATTCGGGCATT
AGTAGTTACGACAACAATAAATCGCAATTGAGAAGGATGAGCGAGGCCGG
CACCAGCGCGGATGCAGTGGCCGCCGAGAAGGAGCGCAAGTTCCGCATCC
AGGCCGCCGCCTTTCTGGGTTTGGTGGGCGGGGTGTCCGCTCTGTTCGGC
TTCTCGCGCACGCTGGCCACCGCCAAGAAGACGGATAGCAAGGTCCTCCA
GCAGGCTGGAACGCGGCAAGGCATGATCCTGATGGACGAGGGCGCCACCC
TGGCCCTGCGGGCGCTGGGCTGGGGCACACTGTACGCCGTGATGGGCACC
GGCGCCTTCTGCTACGGCTTCTGGAAGCTATCCGGAGCCAAGGATTTCCA
GGAGTTCCGCCTCAAGATGGGCAATGCACTGCCAAGAATCACCAAGGACG
AACCACCAGCCAGCCGCACCGATTTCGAGAGTCTCACGGACCTCATGAAA
TACCTGGCAGCCTGGAACAAGGAATAAGCAGCTCACAAATATACACACAA
TTTAAAGTAGACCTAACGCCTGAGTAGACCAGAACATAAAACGAAACCTT
TGTTAACTTCAGTTTACATACAGACAATGTTTTCAAGGAAAAAAAAAAAA
AAAA

RE61805.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG11699-RA 936 CG11699-RA 188..824 1..637 3185 100 Plus
CG11699.a 751 CG11699.a 200..684 153..637 2425 100 Plus
CG11699.a 751 CG11699.a 20..172 1..153 765 100 Plus
Kmn1-RA 1086 Kmn1-RA 1043..1086 637..594 220 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11462065..11462307 153..395 1215 100 Plus
chrX 22417052 chrX 11462368..11462609 396..637 1210 100 Plus
chrX 22417052 chrX 11461823..11461975 1..153 765 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:08:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11570866..11571108 153..395 1215 100 Plus
X 23542271 X 11571169..11571410 396..637 1210 100 Plus
X 23542271 X 11570624..11570776 1..153 765 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11578964..11579206 153..395 1215 100 Plus
X 23527363 X 11579267..11579508 396..637 1210 100 Plus
X 23527363 X 11578722..11578874 1..153 765 100 Plus
Blast to na_te.dros performed on 2019-03-16 23:28:48 has no hits.

RE61805.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:29:54 Download gff for RE61805.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11461823..11461975 1..153 100 -> Plus
chrX 11462066..11462307 154..395 100 -> Plus
chrX 11462368..11462609 396..638 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:28:44 Download gff for RE61805.complete
Subject Subject Range Query Range Percent Splice Strand
CG11699-RA 1..441 87..527 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:56:02 Download gff for RE61805.complete
Subject Subject Range Query Range Percent Splice Strand
CG11699-RA 1..441 87..527 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:20:50 Download gff for RE61805.complete
Subject Subject Range Query Range Percent Splice Strand
CG11699-RA 1..441 87..527 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:37 Download gff for RE61805.complete
Subject Subject Range Query Range Percent Splice Strand
CG11699-RA 1..441 87..527 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:50:37 Download gff for RE61805.complete
Subject Subject Range Query Range Percent Splice Strand
CG11699-RA 1..441 87..527 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:39 Download gff for RE61805.complete
Subject Subject Range Query Range Percent Splice Strand
CG11699-RA 1..637 1..638 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:56:02 Download gff for RE61805.complete
Subject Subject Range Query Range Percent Splice Strand
CG11699-RA 1..637 1..638 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:20:50 Download gff for RE61805.complete
Subject Subject Range Query Range Percent Splice Strand
CG11699-RA 4..640 1..637 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:38 Download gff for RE61805.complete
Subject Subject Range Query Range Percent Splice Strand
CG11699-RA 1..637 1..638 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:50:37 Download gff for RE61805.complete
Subject Subject Range Query Range Percent Splice Strand
CG11699-RA 4..640 1..637 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:29:54 Download gff for RE61805.complete
Subject Subject Range Query Range Percent Splice Strand
X 11570624..11570776 1..153 100 -> Plus
X 11570867..11571108 154..395 100 -> Plus
X 11571169..11571410 396..638 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:29:54 Download gff for RE61805.complete
Subject Subject Range Query Range Percent Splice Strand
X 11570624..11570776 1..153 100 -> Plus
X 11570867..11571108 154..395 100 -> Plus
X 11571169..11571410 396..638 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:29:54 Download gff for RE61805.complete
Subject Subject Range Query Range Percent Splice Strand
X 11570624..11570776 1..153 100 -> Plus
X 11570867..11571108 154..395 100 -> Plus
X 11571169..11571410 396..638 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:20:50 Download gff for RE61805.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11464657..11464809 1..153 100 -> Plus
arm_X 11464900..11465141 154..395 100 -> Plus
arm_X 11465202..11465443 396..638 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:40 Download gff for RE61805.complete
Subject Subject Range Query Range Percent Splice Strand
X 11579267..11579508 396..638 99   Plus
X 11578965..11579206 154..395 100 -> Plus
X 11578722..11578874 1..153 100 -> Plus

RE61805.hyp Sequence

Translation from 2 to 526

> RE61805.hyp
KSGQAISCVVRSNSGISSYDNNKSQLRRMSEAGTSADAVAAEKERKFRIQ
AAAFLGLVGGVSALFGFSRTLATAKKTDSKVLQQAGTRQGMILMDEGATL
ALRALGWGTLYAVMGTGAFCYGFWKLSGAKDFQEFRLKMGNALPRITKDE
PPASRTDFESLTDLMKYLAAWNKE*

RE61805.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG11699-PA 146 CG11699-PA 1..146 29..174 743 100 Plus

RE61805.pep Sequence

Translation from 86 to 526

> RE61805.pep
MSEAGTSADAVAAEKERKFRIQAAAFLGLVGGVSALFGFSRTLATAKKTD
SKVLQQAGTRQGMILMDEGATLALRALGWGTLYAVMGTGAFCYGFWKLSG
AKDFQEFRLKMGNALPRITKDEPPASRTDFESLTDLMKYLAAWNKE*

RE61805.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:31:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20319-PA 146 GF20319-PA 1..146 1..146 696 89.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:31:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18427-PA 146 GG18427-PA 1..146 1..146 746 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17914-PA 146 GH17914-PA 1..146 1..146 645 87.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG11699-PB 146 CG11699-PB 1..146 1..146 743 100 Plus
CG11699-PA 146 CG11699-PA 1..146 1..146 743 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16053-PA 146 GI16053-PA 1..146 1..146 688 88.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26739-PA 146 GL26739-PA 1..146 1..146 693 89.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11150-PA 146 GA11150-PA 1..146 1..146 693 89.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13091-PA 146 GM13091-PA 1..146 1..146 746 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17031-PA 146 GD17031-PA 1..146 1..146 728 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15629-PA 146 GJ15629-PA 1..146 1..146 687 87 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16295-PA 146 GK16295-PA 1..146 1..146 642 82.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15945-PA 146 GE15945-PA 1..146 1..146 750 99.3 Plus