BDGP Sequence Production Resources |
Search the DGRC for RE61805
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 618 |
Well: | 5 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG11699-RA |
Protein status: | RE61805.pep: gold |
Preliminary Size: | 829 |
Sequenced Size: | 654 |
Gene | Date | Evidence |
---|---|---|
CG11699 | 2001-12-14 | Blastp of sequenced clone |
CG11699 | 2002-01-01 | Sim4 clustering to Release 2 |
CG11699 | 2003-01-01 | Sim4 clustering to Release 3 |
CG11699 | 2008-04-29 | Release 5.5 accounting |
CG11699 | 2008-08-15 | Release 5.9 accounting |
CG11699 | 2008-12-18 | 5.12 accounting |
654 bp (654 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071552
> RE61805.complete TCAAGAGCGGTCAAGCAATCAGCTGTGTTGTGCGATCCAATTCGGGCATT AGTAGTTACGACAACAATAAATCGCAATTGAGAAGGATGAGCGAGGCCGG CACCAGCGCGGATGCAGTGGCCGCCGAGAAGGAGCGCAAGTTCCGCATCC AGGCCGCCGCCTTTCTGGGTTTGGTGGGCGGGGTGTCCGCTCTGTTCGGC TTCTCGCGCACGCTGGCCACCGCCAAGAAGACGGATAGCAAGGTCCTCCA GCAGGCTGGAACGCGGCAAGGCATGATCCTGATGGACGAGGGCGCCACCC TGGCCCTGCGGGCGCTGGGCTGGGGCACACTGTACGCCGTGATGGGCACC GGCGCCTTCTGCTACGGCTTCTGGAAGCTATCCGGAGCCAAGGATTTCCA GGAGTTCCGCCTCAAGATGGGCAATGCACTGCCAAGAATCACCAAGGACG AACCACCAGCCAGCCGCACCGATTTCGAGAGTCTCACGGACCTCATGAAA TACCTGGCAGCCTGGAACAAGGAATAAGCAGCTCACAAATATACACACAA TTTAAAGTAGACCTAACGCCTGAGTAGACCAGAACATAAAACGAAACCTT TGTTAACTTCAGTTTACATACAGACAATGTTTTCAAGGAAAAAAAAAAAA AAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11699-RA | 936 | CG11699-RA | 188..824 | 1..637 | 3185 | 100 | Plus |
CG11699.a | 751 | CG11699.a | 200..684 | 153..637 | 2425 | 100 | Plus |
CG11699.a | 751 | CG11699.a | 20..172 | 1..153 | 765 | 100 | Plus |
Kmn1-RA | 1086 | Kmn1-RA | 1043..1086 | 637..594 | 220 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 11462065..11462307 | 153..395 | 1215 | 100 | Plus |
chrX | 22417052 | chrX | 11462368..11462609 | 396..637 | 1210 | 100 | Plus |
chrX | 22417052 | chrX | 11461823..11461975 | 1..153 | 765 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 11461823..11461975 | 1..153 | 100 | -> | Plus |
chrX | 11462066..11462307 | 154..395 | 100 | -> | Plus |
chrX | 11462368..11462609 | 396..638 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11699-RA | 1..441 | 87..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11699-RA | 1..441 | 87..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11699-RA | 1..441 | 87..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11699-RA | 1..441 | 87..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11699-RA | 1..441 | 87..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11699-RA | 1..637 | 1..638 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11699-RA | 1..637 | 1..638 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11699-RA | 4..640 | 1..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11699-RA | 1..637 | 1..638 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11699-RA | 4..640 | 1..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 11570624..11570776 | 1..153 | 100 | -> | Plus |
X | 11570867..11571108 | 154..395 | 100 | -> | Plus |
X | 11571169..11571410 | 396..638 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 11570624..11570776 | 1..153 | 100 | -> | Plus |
X | 11570867..11571108 | 154..395 | 100 | -> | Plus |
X | 11571169..11571410 | 396..638 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 11570624..11570776 | 1..153 | 100 | -> | Plus |
X | 11570867..11571108 | 154..395 | 100 | -> | Plus |
X | 11571169..11571410 | 396..638 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 11464657..11464809 | 1..153 | 100 | -> | Plus |
arm_X | 11464900..11465141 | 154..395 | 100 | -> | Plus |
arm_X | 11465202..11465443 | 396..638 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 11579267..11579508 | 396..638 | 99 | Plus | |
X | 11578965..11579206 | 154..395 | 100 | -> | Plus |
X | 11578722..11578874 | 1..153 | 100 | -> | Plus |
Translation from 2 to 526
> RE61805.hyp KSGQAISCVVRSNSGISSYDNNKSQLRRMSEAGTSADAVAAEKERKFRIQ AAAFLGLVGGVSALFGFSRTLATAKKTDSKVLQQAGTRQGMILMDEGATL ALRALGWGTLYAVMGTGAFCYGFWKLSGAKDFQEFRLKMGNALPRITKDE PPASRTDFESLTDLMKYLAAWNKE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11699-PA | 146 | CG11699-PA | 1..146 | 29..174 | 743 | 100 | Plus |
Translation from 86 to 526
> RE61805.pep MSEAGTSADAVAAEKERKFRIQAAAFLGLVGGVSALFGFSRTLATAKKTD SKVLQQAGTRQGMILMDEGATLALRALGWGTLYAVMGTGAFCYGFWKLSG AKDFQEFRLKMGNALPRITKDEPPASRTDFESLTDLMKYLAAWNKE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20319-PA | 146 | GF20319-PA | 1..146 | 1..146 | 696 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18427-PA | 146 | GG18427-PA | 1..146 | 1..146 | 746 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17914-PA | 146 | GH17914-PA | 1..146 | 1..146 | 645 | 87.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11699-PB | 146 | CG11699-PB | 1..146 | 1..146 | 743 | 100 | Plus |
CG11699-PA | 146 | CG11699-PA | 1..146 | 1..146 | 743 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16053-PA | 146 | GI16053-PA | 1..146 | 1..146 | 688 | 88.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26739-PA | 146 | GL26739-PA | 1..146 | 1..146 | 693 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11150-PA | 146 | GA11150-PA | 1..146 | 1..146 | 693 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM13091-PA | 146 | GM13091-PA | 1..146 | 1..146 | 746 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17031-PA | 146 | GD17031-PA | 1..146 | 1..146 | 728 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15629-PA | 146 | GJ15629-PA | 1..146 | 1..146 | 687 | 87 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16295-PA | 146 | GK16295-PA | 1..146 | 1..146 | 642 | 82.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE15945-PA | 146 | GE15945-PA | 1..146 | 1..146 | 750 | 99.3 | Plus |