Clone RE61847 Report

Search the DGRC for RE61847

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:618
Well:47
Vector:pFlc-1
Associated Gene/TranscriptRoc2-RA
Protein status:RE61847.pep: gold
Preliminary Size:498
Sequenced Size:602

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8998 2002-01-01 Sim4 clustering to Release 2
CG8998 2002-04-21 Blastp of sequenced clone
CG8998 2003-01-01 Sim4 clustering to Release 3
Roc2 2008-04-29 Release 5.5 accounting
Roc2 2008-08-15 Release 5.9 accounting
Roc2 2008-12-18 5.12 accounting

Clone Sequence Records

RE61847.complete Sequence

602 bp (602 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113544

> RE61847.complete
AGTTTTCCCTTGTTTTGGTGTGGCCACACTGACTTTTGGCTTGCTATTGT
TTACATTCAATTATTTCGACTTCTTATTTGTTGGAGGATATACACAAGAA
ACAAAAAAAAAATATTAAAAAACCGAATCTCATTAGCCCAGTGGATTGGT
CAGTTTCCCAGACTTTTTTGACATGGCTGATGATCCAGAAAACTCAGTGG
ATAGGCCCACAGACGACGGAGATGCCGGCAAACCGGAAAAAATGTTTACG
CTGAAGAAATGGAACGCAGTTGCAATGTGGAGTTGGGATGTGGAATGCGA
TATCTGTGCCATTTGCCGTGTTCAAGTTATGGATTCCTGCCTTCGCTGCC
AGGCGGACAACAAGCGGGATGTGATGGGTCGCCAGGACTGCGTGGTGGTT
TGGGGCGAGTGCAACCACTCCTTTCACCACTGCTGCATGTCGCTGTGGGT
CAAGCAGAACAACCGATGCCCGTTGTGCCAGCAGGAGTGGTCCATTCAGC
GCATGGGAAAATAAATATCTCCACCTGATATTACTTTATGCTGTGTCTAA
AAAAACAACTATAAATAAAAAATTAAAAGTATAAAAGAAAAAAAAAAAAA
AA

RE61847.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
Roc2-RA 671 Roc2-RA 3..587 1..585 2925 100 Plus
Roc2-RB 736 Roc2-RB 160..661 84..585 2510 100 Plus
nc_6092.a 473 nc_6092.a 258..473 333..548 1080 100 Plus
Roc2-RB 736 Roc2-RB 1..63 21..83 315 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7540155..7540408 585..332 1270 100 Minus
chr2R 21145070 chr2R 7565510..7565759 332..83 1250 100 Minus
chr2R 21145070 chr2R 7566573..7566656 84..1 405 98.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:08:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11652831..11653084 585..332 1270 100 Minus
2R 25286936 2R 11678206..11678455 332..83 1250 100 Minus
2R 25286936 2R 11679269..11679352 84..1 420 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11654030..11654283 585..332 1270 100 Minus
2R 25260384 2R 11679405..11679654 332..83 1250 100 Minus
2R 25260384 2R 11680468..11680551 84..1 420 100 Minus
Blast to na_te.dros performed on 2019-03-16 21:18:35 has no hits.

RE61847.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:19:38 Download gff for RE61847.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7540152..7540407 333..587 99 <- Minus
chr2R 7565510..7565758 84..332 100 <- Minus
chr2R 7566574..7566656 1..83 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:32:35 Download gff for RE61847.complete
Subject Subject Range Query Range Percent Splice Strand
Roc2-RA 1..342 173..514 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:59:33 Download gff for RE61847.complete
Subject Subject Range Query Range Percent Splice Strand
Roc2-RB 1..342 173..514 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:37:09 Download gff for RE61847.complete
Subject Subject Range Query Range Percent Splice Strand
Roc2-RA 1..342 173..514 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:52:54 Download gff for RE61847.complete
Subject Subject Range Query Range Percent Splice Strand
Roc2-RA 1..342 173..514 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:15:07 Download gff for RE61847.complete
Subject Subject Range Query Range Percent Splice Strand
Roc2-RA 1..342 173..514 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:32:31 Download gff for RE61847.complete
Subject Subject Range Query Range Percent Splice Strand
Roc2-RA 1..585 1..587 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:59:33 Download gff for RE61847.complete
Subject Subject Range Query Range Percent Splice Strand
Roc2-RA 1..585 1..587 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:37:09 Download gff for RE61847.complete
Subject Subject Range Query Range Percent Splice Strand
Roc2-RA 3..584 1..582 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:52:54 Download gff for RE61847.complete
Subject Subject Range Query Range Percent Splice Strand
Roc2-RA 1..585 1..587 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:15:07 Download gff for RE61847.complete
Subject Subject Range Query Range Percent Splice Strand
Roc2-RA 3..584 1..582 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:38 Download gff for RE61847.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11652828..11653083 333..587 99 <- Minus
2R 11678206..11678454 84..332 100 <- Minus
2R 11679270..11679352 1..83 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:38 Download gff for RE61847.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11652828..11653083 333..587 99 <- Minus
2R 11678206..11678454 84..332 100 <- Minus
2R 11679270..11679352 1..83 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:38 Download gff for RE61847.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11652828..11653083 333..587 99 <- Minus
2R 11678206..11678454 84..332 100 <- Minus
2R 11679270..11679352 1..83 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:37:09 Download gff for RE61847.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7540333..7540588 333..587 99 <- Minus
arm_2R 7565711..7565959 84..332 100 <- Minus
arm_2R 7566775..7566857 1..83 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:24:59 Download gff for RE61847.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11654027..11654282 333..587 99 <- Minus
2R 11679405..11679653 84..332 100 <- Minus
2R 11680469..11680551 1..83 100   Minus

RE61847.hyp Sequence

Translation from 172 to 513

> RE61847.hyp
MADDPENSVDRPTDDGDAGKPEKMFTLKKWNAVAMWSWDVECDICAICRV
QVMDSCLRCQADNKRDVMGRQDCVVVWGECNHSFHHCCMSLWVKQNNRCP
LCQQEWSIQRMGK*

RE61847.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Roc2-PB 113 CG8998-PB 1..113 1..113 658 100 Plus
Roc2-PA 113 CG8998-PA 1..113 1..113 658 100 Plus
Roc1a-PD 108 CG16982-PD 5..107 6..112 274 43.9 Plus
Roc1a-PA 108 CG16982-PA 5..107 6..112 274 43.9 Plus
Roc1b-PA 122 CG16988-PA 15..122 4..113 263 42.3 Plus

RE61847.pep Sequence

Translation from 172 to 513

> RE61847.pep
MADDPENSVDRPTDDGDAGKPEKMFTLKKWNAVAMWSWDVECDICAICRV
QVMDSCLRCQADNKRDVMGRQDCVVVWGECNHSFHHCCMSLWVKQNNRCP
LCQQEWSIQRMGK*

RE61847.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19783-PA 105 GF19783-PA 1..105 1..113 489 84.1 Plus
Dana\GF21496-PA 146 GF21496-PA 40..145 6..112 271 48.1 Plus
Dana\GF20493-PA 194 GF20493-PA 85..194 2..113 261 44.6 Plus
Dana\GF20771-PA 154 GF20771-PA 62..153 19..112 256 53.2 Plus
Dana\GF24894-PA 119 GF24894-PA 14..118 7..112 250 46.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22636-PA 113 GG22636-PA 1..113 1..113 582 98.2 Plus
Dere\GG12803-PA 108 GG12803-PA 4..107 3..112 246 43.6 Plus
Dere\GG14721-PA 122 GG14721-PA 21..121 10..112 239 45.2 Plus
Dere\GG24061-PA 85 GG24061-PA 4..82 26..108 138 34.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20492-PA 111 GH20492-PA 1..111 1..113 528 92.1 Plus
Dgri\GH10088-PA 159 GH10088-PA 63..159 15..113 266 46.5 Plus
Dgri\GH19723-PA 112 GH19723-PA 2..110 4..112 258 46.8 Plus
Dgri\GH17811-PA 108 GH17811-PA 4..107 3..112 246 43.6 Plus
Dgri\GH15458-PA 128 GH15458-PA 33..127 16..112 237 48 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
Roc2-PB 113 CG8998-PB 1..113 1..113 658 100 Plus
Roc2-PA 113 CG8998-PA 1..113 1..113 658 100 Plus
Roc1a-PD 108 CG16982-PD 5..107 6..112 274 43.9 Plus
Roc1a-PA 108 CG16982-PA 5..107 6..112 274 43.9 Plus
Roc1b-PA 122 CG16988-PA 15..122 4..113 263 42.3 Plus
Roc1a-PC 136 CG16982-PC 53..135 28..112 258 48.2 Plus
lmgA-PB 85 CG34440-PB 4..80 26..106 177 35.7 Plus
lmgA-PA 85 CG18042-PA 4..80 26..106 177 35.7 Plus
lmgA-PD 85 CG34440-PD 4..80 26..106 177 35.7 Plus
lmgA-PC 85 CG34440-PC 4..80 26..106 177 35.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21036-PA 111 GI21036-PA 1..111 1..113 530 92.1 Plus
Dmoj\GI14277-PA 159 GI14277-PA 59..159 11..113 276 47.6 Plus
Dmoj\GI16422-PA 108 GI16422-PA 5..107 6..112 245 43.9 Plus
Dmoj\GI20142-PA 147 GI20142-PA 59..147 23..113 242 47.3 Plus
Dmoj\GI16738-PA 130 GI16738-PA 24..129 4..112 236 42.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10672-PA 113 GL10672-PA 1..113 1..113 568 94.7 Plus
Dper\GL13357-PA 108 GL13357-PA 4..107 3..112 246 43.6 Plus
Dper\GL14784-PA 284 GL14784-PA 198..284 25..113 245 48.3 Plus
Dper\GL22584-PA 123 GL22584-PA 16..122 3..112 230 41.8 Plus
Dper\GL10569-PA 102 GL10569-PA 16..102 25..113 204 41.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21465-PA 113 GA21465-PA 1..113 1..113 568 94.7 Plus
Dpse\GA22841-PA 108 GA22841-PA 4..107 3..112 246 43.6 Plus
Dpse\GA23017-PA 150 GA23017-PA 49..150 10..113 239 43.3 Plus
Dpse\GA14260-PA 123 GA14260-PA 16..122 3..112 230 41.8 Plus
Dpse\GA24410-PA 102 GA24410-PA 16..102 25..113 204 41.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20415-PA 113 GM20415-PA 1..113 1..113 588 99.1 Plus
Dsec\GM19082-PA 108 GM19082-PA 5..107 6..112 245 43.9 Plus
Dsec\GM14339-PA 122 GM14339-PA 21..122 10..113 241 44.8 Plus
Dsec\GM12813-PA 85 GM12813-PA 4..82 26..108 138 34.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25891-PA 113 GD25891-PA 1..113 1..113 588 99.1 Plus
Dsim\GD16520-PA 108 GD16520-PA 5..107 6..112 245 43.9 Plus
Dsim\GD11014-PA 122 GD11014-PA 21..122 10..113 241 44.8 Plus
Dsim\GD22391-PA 85 GD22391-PA 4..82 26..108 138 34.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21963-PA 111 GJ21963-PA 1..111 1..113 534 93 Plus
Dvir\GJ16241-PA 149 GJ16241-PA 49..149 11..113 280 47.6 Plus
Dvir\GJ15825-PA 108 GJ15825-PA 4..107 3..112 246 43.6 Plus
Dvir\GJ12485-PA 131 GJ12485-PA 22..130 1..112 240 42 Plus
Dvir\GJ22419-PA 117 GJ22419-PA 28..117 22..113 238 46.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13170-PA 121 GK13170-PA 15..121 4..113 260 43.6 Plus
Dwil\GK18099-PA 160 GK18099-PA 59..160 10..113 252 45.2 Plus
Dwil\GK16427-PA 108 GK16427-PA 4..107 3..112 246 43.6 Plus
Dwil\GK15981-PA 112 GK15981-PA 23..111 22..112 239 47.3 Plus
Dwil\GK20831-PA 112 GK20831-PA 23..111 22..112 239 47.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13508-PA 113 GE13508-PA 1..113 1..113 593 100 Plus
Dyak\GE16630-PA 111 GE16630-PA 7..110 3..112 247 43.6 Plus
Dyak\GE21084-PA 122 GE21084-PA 15..121 4..112 240 44.5 Plus
Dyak\GE17622-PA 137 GE17622-PA 38..136 12..112 237 46.1 Plus
Dyak\GE10872-PA 85 GE10872-PA 4..82 26..108 138 34.9 Plus