Clone RE61949 Report

Search the DGRC for RE61949

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:619
Well:49
Vector:pFlc-1
Associated Gene/TranscriptCG8960-RB
Protein status:RE61949.pep: gold
Sequenced Size:631

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8960 2004-08-13 Blastp of sequenced clone
CG8960 2008-04-29 Release 5.5 accounting
CG8960 2008-08-15 Release 5.9 accounting
CG8960 2008-12-18 5.12 accounting

Clone Sequence Records

RE61949.complete Sequence

631 bp (631 high quality bases) assembled on 2004-08-13

GenBank Submission: BT015984

> RE61949.complete
ATTCCGTCGATGTACTTCCACAGCGATAGTCAGCCCCGAATCGTCGTCCG
TTGAGAGCCGCCGCGCAAACATCTGTTTGCCACCAACCTGATCATCCTGC
TGATGATCTACTTGATGCGCAAGTGCCTGCAGCTCTTCTGCATCATCGAG
AACCGCGCCGTTCATCCGGCCGAGGAAGAGGAGAAGGAGGTCAAGTTGCC
GGAAAGGGAGATCCTCCAGAAGCGCCGCGGCGGCTTCACCATCATCCCAG
CTGCCATGCACCAGAGCATGCACGGCTTCGGCTACGGCGAGGGTCACTAC
CAGATCTTTGTGGAGAAGAAGGAGCGTAACCTCCCAACCAAATCGCGCCT
TAACGCGGCCACTGCTGAAGTCAAGCTGAATCCCAATTAGTTAGTTGCCC
GCGACCAAAGGGAACCACTGACATCCCAGCATGTCAATGACAATGTGCCA
ATTGAGCCCAGCAAAGCAAAATCAAACCCAATCCACAAATATCCCTCTAC
ATCCAAGTCTTCTTCAATAGTCTAAATAATATCTAATGCATGGAACAACA
AACACTTATTTTGTACAGTCATCAAAGCGCATTATTGGCCATAATAAAAA
ATGAAAAAAAATAAGAAAAAAAAAAAAAAAA

RE61949.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:51:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG8960-RB 609 CG8960-RB 1..609 1..609 3045 100 Plus
CG8960-RA 1060 CG8960-RA 506..1060 59..613 2775 100 Plus
CG8960-RA 1060 CG8960-RA 409..444 23..58 180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2196972..2197524 59..611 2720 99.5 Plus
chr3L 24539361 chr3L 2196853..2196910 1..58 290 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:08:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:07:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2197553..2198107 59..613 2775 100 Plus
3L 28110227 3L 2197434..2197491 1..58 290 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2197553..2198107 59..613 2775 100 Plus
3L 28103327 3L 2197434..2197491 1..58 290 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:07:46 has no hits.

RE61949.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:08:45 Download gff for RE61949.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2196972..2197508 59..595 99   Plus
chr3L 2196853..2196910 1..58 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:28:48 Download gff for RE61949.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 7..345 51..390 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:47:34 Download gff for RE61949.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 7..345 51..390 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:03:01 Download gff for RE61949.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 7..345 51..390 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:28:36 Download gff for RE61949.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 7..345 51..390 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:29:01 Download gff for RE61949.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 7..345 51..390 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:56:56 Download gff for RE61949.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RB 1..595 1..595 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:47:34 Download gff for RE61949.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RB 1..595 1..595 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:03:01 Download gff for RE61949.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 383..418 23..58 100 -> Plus
CG8960-RA 480..1016 59..595 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:28:36 Download gff for RE61949.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RB 1..595 1..595 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:29:01 Download gff for RE61949.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 383..418 23..58 100 -> Plus
CG8960-RA 480..1016 59..595 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:08:45 Download gff for RE61949.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2197434..2197491 1..58 100 -> Plus
3L 2197553..2198089 59..595 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:08:45 Download gff for RE61949.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2197434..2197491 1..58 100 -> Plus
3L 2197553..2198089 59..595 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:08:45 Download gff for RE61949.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2197434..2197491 1..58 100 -> Plus
3L 2197553..2198089 59..595 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:03:01 Download gff for RE61949.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2197434..2197491 1..58 100 -> Plus
arm_3L 2197553..2198089 59..595 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:04:52 Download gff for RE61949.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2197553..2198089 59..595 100   Plus
3L 2197434..2197491 1..58 100 -> Plus

RE61949.pep Sequence

Translation from 102 to 389

> RE61949.pep
MIYLMRKCLQLFCIIENRAVHPAEEEEKEVKLPEREILQKRRGGFTIIPA
AMHQSMHGFGYGEGHYQIFVEKKERNLPTKSRLNAATAEVKLNPN*

RE61949.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24854-PA 113 GF24854-PA 20..113 1..95 376 76.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14843-PA 113 GG14843-PA 20..113 1..95 408 89.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14997-PA 116 GH14997-PA 20..116 1..95 338 67.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG8960-PB 95 CG8960-PB 1..95 1..95 498 100 Plus
CG8960-PA 114 CG8960-PA 20..114 1..95 498 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:42:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13159-PA 115 GI13159-PA 20..115 1..95 330 66 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:42:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21436-PA 121 GA21436-PA 20..121 1..95 345 68.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:42:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14468-PA 114 GM14468-PA 20..114 1..95 490 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:42:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13665-PA 114 GD13665-PA 20..114 1..95 498 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11934-PA 115 GJ11934-PA 20..115 1..95 341 68 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12533-PA 118 GK12533-PA 20..118 1..95 364 71 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21207-PA 109 GE21207-PA 20..109 1..95 442 89.5 Plus

RE61949.hyp Sequence

Translation from 102 to 389

> RE61949.hyp
MIYLMRKCLQLFCIIENRAVHPAEEEEKEVKLPEREILQKRRGGFTIIPA
AMHQSMHGFGYGEGHYQIFVEKKERNLPTKSRLNAATAEVKLNPN*

RE61949.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:36:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG8960-PB 95 CG8960-PB 1..95 1..95 498 100 Plus
CG8960-PA 114 CG8960-PA 20..114 1..95 498 100 Plus