BDGP Sequence Production Resources |
Search the DGRC for RE61949
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 619 |
Well: | 49 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG8960-RB |
Protein status: | RE61949.pep: gold |
Sequenced Size: | 631 |
Gene | Date | Evidence |
---|---|---|
CG8960 | 2004-08-13 | Blastp of sequenced clone |
CG8960 | 2008-04-29 | Release 5.5 accounting |
CG8960 | 2008-08-15 | Release 5.9 accounting |
CG8960 | 2008-12-18 | 5.12 accounting |
631 bp (631 high quality bases) assembled on 2004-08-13
GenBank Submission: BT015984
> RE61949.complete ATTCCGTCGATGTACTTCCACAGCGATAGTCAGCCCCGAATCGTCGTCCG TTGAGAGCCGCCGCGCAAACATCTGTTTGCCACCAACCTGATCATCCTGC TGATGATCTACTTGATGCGCAAGTGCCTGCAGCTCTTCTGCATCATCGAG AACCGCGCCGTTCATCCGGCCGAGGAAGAGGAGAAGGAGGTCAAGTTGCC GGAAAGGGAGATCCTCCAGAAGCGCCGCGGCGGCTTCACCATCATCCCAG CTGCCATGCACCAGAGCATGCACGGCTTCGGCTACGGCGAGGGTCACTAC CAGATCTTTGTGGAGAAGAAGGAGCGTAACCTCCCAACCAAATCGCGCCT TAACGCGGCCACTGCTGAAGTCAAGCTGAATCCCAATTAGTTAGTTGCCC GCGACCAAAGGGAACCACTGACATCCCAGCATGTCAATGACAATGTGCCA ATTGAGCCCAGCAAAGCAAAATCAAACCCAATCCACAAATATCCCTCTAC ATCCAAGTCTTCTTCAATAGTCTAAATAATATCTAATGCATGGAACAACA AACACTTATTTTGTACAGTCATCAAAGCGCATTATTGGCCATAATAAAAA ATGAAAAAAAATAAGAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 2196972..2197508 | 59..595 | 99 | Plus | |
chr3L | 2196853..2196910 | 1..58 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8960-RA | 7..345 | 51..390 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8960-RA | 7..345 | 51..390 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8960-RA | 7..345 | 51..390 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8960-RA | 7..345 | 51..390 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8960-RA | 7..345 | 51..390 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8960-RB | 1..595 | 1..595 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8960-RB | 1..595 | 1..595 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8960-RA | 383..418 | 23..58 | 100 | -> | Plus |
CG8960-RA | 480..1016 | 59..595 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8960-RB | 1..595 | 1..595 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8960-RA | 383..418 | 23..58 | 100 | -> | Plus |
CG8960-RA | 480..1016 | 59..595 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 2197434..2197491 | 1..58 | 100 | -> | Plus |
3L | 2197553..2198089 | 59..595 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 2197434..2197491 | 1..58 | 100 | -> | Plus |
3L | 2197553..2198089 | 59..595 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 2197434..2197491 | 1..58 | 100 | -> | Plus |
3L | 2197553..2198089 | 59..595 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 2197434..2197491 | 1..58 | 100 | -> | Plus |
arm_3L | 2197553..2198089 | 59..595 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 2197553..2198089 | 59..595 | 100 | Plus | |
3L | 2197434..2197491 | 1..58 | 100 | -> | Plus |
Translation from 102 to 389
> RE61949.pep MIYLMRKCLQLFCIIENRAVHPAEEEEKEVKLPEREILQKRRGGFTIIPA AMHQSMHGFGYGEGHYQIFVEKKERNLPTKSRLNAATAEVKLNPN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24854-PA | 113 | GF24854-PA | 20..113 | 1..95 | 376 | 76.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14843-PA | 113 | GG14843-PA | 20..113 | 1..95 | 408 | 89.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14997-PA | 116 | GH14997-PA | 20..116 | 1..95 | 338 | 67.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG8960-PB | 95 | CG8960-PB | 1..95 | 1..95 | 498 | 100 | Plus |
CG8960-PA | 114 | CG8960-PA | 20..114 | 1..95 | 498 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13159-PA | 115 | GI13159-PA | 20..115 | 1..95 | 330 | 66 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21436-PA | 121 | GA21436-PA | 20..121 | 1..95 | 345 | 68.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14468-PA | 114 | GM14468-PA | 20..114 | 1..95 | 490 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13665-PA | 114 | GD13665-PA | 20..114 | 1..95 | 498 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11934-PA | 115 | GJ11934-PA | 20..115 | 1..95 | 341 | 68 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12533-PA | 118 | GK12533-PA | 20..118 | 1..95 | 364 | 71 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21207-PA | 109 | GE21207-PA | 20..109 | 1..95 | 442 | 89.5 | Plus |
Translation from 102 to 389
> RE61949.hyp MIYLMRKCLQLFCIIENRAVHPAEEEEKEVKLPEREILQKRRGGFTIIPA AMHQSMHGFGYGEGHYQIFVEKKERNLPTKSRLNAATAEVKLNPN*