Clone RE61993 Report

Search the DGRC for RE61993

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:619
Well:93
Vector:pFlc-1
Associated Gene/TranscriptCG11134-RA
Protein status:RE61993.pep: gold
Preliminary Size:796
Sequenced Size:913

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11134 2001-12-16 Blastp of sequenced clone
CG11134 2002-01-01 Sim4 clustering to Release 2
CG11134 2003-01-01 Sim4 clustering to Release 3
CG11134 2008-04-29 Release 5.5 accounting
CG11134 2008-08-15 Release 5.9 accounting
CG11134 2008-12-18 5.12 accounting

Clone Sequence Records

RE61993.complete Sequence

913 bp (913 high quality bases) assembled on 2001-12-16

GenBank Submission: AY071553

> RE61993.complete
ATTGTTTACATTCGTGATTTGTCGCTTTCAGAATCCCTTTATCTCCCGTT
ATCAGTGTCGCACGGCGACGAAGATTACGTCCCACGAAAGTCACATTGTC
AGCGAGATGGCCCTCTCGATCTTCAAAGACTTGCCGGCGGAGCATCCTCG
CCACTTGATTCCCTCGCTATGCAGGCAATTCTATCATTTGGGATGGGTGA
CCGGCACAGGAGGTGGCATGAGCATTAAGTACAACGATGAGATCTACATA
GCACCGTCGGGCGTCCAGAAGGAGCGAATGCAGCCGGAGGATCTCTTCGT
GCAGGATATAACCGGCAAGGATCTGCAACTGCCGCCTGAGATCAAGGGCC
TGAAGAAGAGCCAATGTACGCCGCTCTTTATGCTGGCCTATCAGCATCGG
CAGGCGGGAGCCGTCATCCACACCCATTCGCAGCACGCCGTAATGGCCAC
GCTCCTGTGGCCAGGGAAAACCTTCCGCTGCACCCACTTGGAGATGATCA
AGGGCGTCTACGATGAGGCGGACAAGCGATATTTGCGCTACGACGAGGAG
CTCGTCGTACCGATCATCGAGAACACACCCTTTGAACGCGACCTGGCCGA
CAGTATGTACGCCGCCATGATGGAGTATCCGGGCTGCAGTGCGATCCTGG
TTCGACGACACGGCGTCTACGTTTGGGGACAGAACTGGGAGAAGGCCAAA
ACCATGTCGGAATGCTATGACTATCTCTTCTCCATTGCCGTGGAAATGAA
GAAGGCCGGAATCGATCCGGAAAAGTTCGAGAGCTCATAAGGAAGTGAAG
CTGATACGAACGCACATTCTACTTGTCGTTTAACCCTATAAATTGATGCA
TTTACTAACTGAAATCCATTGGTCAATGCAAAATAATAGTACTGAATAAA
AAAAAAAAAAAAA

RE61993.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG11134-RA 1081 CG11134-RA 131..1029 1..899 4495 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13629169..13629641 235..707 2350 99.8 Plus
chrX 22417052 chrX 13628872..13629105 1..234 1170 100 Plus
chrX 22417052 chrX 13629709..13629906 700..897 975 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:08:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13738440..13738912 235..707 2365 100 Plus
X 23542271 X 13738143..13738376 1..234 1170 100 Plus
X 23542271 X 13738980..13739179 700..899 985 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13746538..13747010 235..707 2365 100 Plus
X 23527363 X 13746241..13746474 1..234 1170 100 Plus
X 23527363 X 13747078..13747277 700..899 985 99.5 Plus
Blast to na_te.dros performed on 2019-03-15 14:27:42 has no hits.

RE61993.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:28:39 Download gff for RE61993.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13628872..13629105 1..234 100 -> Plus
chrX 13629169..13629639 235..705 99 -> Plus
chrX 13629715..13629906 706..897 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:28:49 Download gff for RE61993.complete
Subject Subject Range Query Range Percent Splice Strand
CG11134-RA 1..684 107..790 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:20 Download gff for RE61993.complete
Subject Subject Range Query Range Percent Splice Strand
CG11134-RA 1..684 107..790 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:29:24 Download gff for RE61993.complete
Subject Subject Range Query Range Percent Splice Strand
CG11134-RA 1..684 107..790 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:25:55 Download gff for RE61993.complete
Subject Subject Range Query Range Percent Splice Strand
CG11134-RA 1..684 107..790 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:59:04 Download gff for RE61993.complete
Subject Subject Range Query Range Percent Splice Strand
CG11134-RA 1..684 107..790 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:27:39 Download gff for RE61993.complete
Subject Subject Range Query Range Percent Splice Strand
CG11134-RA 1..897 1..897 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:20 Download gff for RE61993.complete
Subject Subject Range Query Range Percent Splice Strand
CG11134-RA 1..897 1..897 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:29:24 Download gff for RE61993.complete
Subject Subject Range Query Range Percent Splice Strand
CG11134-RA 5..901 1..897 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:25:55 Download gff for RE61993.complete
Subject Subject Range Query Range Percent Splice Strand
CG11134-RA 1..897 1..897 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:59:04 Download gff for RE61993.complete
Subject Subject Range Query Range Percent Splice Strand
CG11134-RA 5..901 1..897 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:28:39 Download gff for RE61993.complete
Subject Subject Range Query Range Percent Splice Strand
X 13738143..13738376 1..234 100 -> Plus
X 13738440..13738910 235..705 100 -> Plus
X 13738986..13739177 706..897 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:28:39 Download gff for RE61993.complete
Subject Subject Range Query Range Percent Splice Strand
X 13738143..13738376 1..234 100 -> Plus
X 13738440..13738910 235..705 100 -> Plus
X 13738986..13739177 706..897 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:28:39 Download gff for RE61993.complete
Subject Subject Range Query Range Percent Splice Strand
X 13738143..13738376 1..234 100 -> Plus
X 13738440..13738910 235..705 100 -> Plus
X 13738986..13739177 706..897 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:29:24 Download gff for RE61993.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13632176..13632409 1..234 100 -> Plus
arm_X 13632473..13632943 235..705 100 -> Plus
arm_X 13633019..13633210 706..897 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:01:31 Download gff for RE61993.complete
Subject Subject Range Query Range Percent Splice Strand
X 13746241..13746474 1..234 100 -> Plus
X 13746538..13747008 235..705 100 -> Plus
X 13747084..13747275 706..897 100   Plus

RE61993.hyp Sequence

Translation from 0 to 789

> RE61993.hyp
LFTFVICRFQNPFISRYQCRTATKITSHESHIVSEMALSIFKDLPAEHPR
HLIPSLCRQFYHLGWVTGTGGGMSIKYNDEIYIAPSGVQKERMQPEDLFV
QDITGKDLQLPPEIKGLKKSQCTPLFMLAYQHRQAGAVIHTHSQHAVMAT
LLWPGKTFRCTHLEMIKGVYDEADKRYLRYDEELVVPIIENTPFERDLAD
SMYAAMMEYPGCSAILVRRHGVYVWGQNWEKAKTMSECYDYLFSIAVEMK
KAGIDPEKFESS*

RE61993.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG11134-PB 227 CG11134-PB 1..227 36..262 1221 100 Plus
CG11134-PA 227 CG11134-PA 1..227 36..262 1221 100 Plus

RE61993.pep Sequence

Translation from 106 to 789

> RE61993.pep
MALSIFKDLPAEHPRHLIPSLCRQFYHLGWVTGTGGGMSIKYNDEIYIAP
SGVQKERMQPEDLFVQDITGKDLQLPPEIKGLKKSQCTPLFMLAYQHRQA
GAVIHTHSQHAVMATLLWPGKTFRCTHLEMIKGVYDEADKRYLRYDEELV
VPIIENTPFERDLADSMYAAMMEYPGCSAILVRRHGVYVWGQNWEKAKTM
SECYDYLFSIAVEMKKAGIDPEKFESS*

RE61993.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22600-PA 227 GF22600-PA 1..227 1..227 1199 96.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17808-PA 227 GG17808-PA 1..227 1..227 1229 99.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11851-PA 230 GH11851-PA 1..225 1..225 1127 89.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG11134-PB 227 CG11134-PB 1..227 1..227 1221 100 Plus
CG11134-PA 227 CG11134-PA 1..227 1..227 1221 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14333-PA 227 GI14333-PA 1..227 1..227 1143 90.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19864-PA 216 GL19864-PA 1..210 1..224 915 78.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10783-PA 230 GA10783-PA 1..227 1..227 1111 88.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17635-PA 227 GM17635-PA 1..227 1..227 1232 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17142-PA 227 GD17142-PA 1..227 1..227 1232 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19387-PA 230 GJ19387-PA 1..227 1..227 1170 93 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25216-PA 228 GK25216-PA 1..227 1..227 1149 91.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17104-PA 227 GE17104-PA 1..226 1..226 1218 99.1 Plus