Clone RE62581 Report

Search the DGRC for RE62581

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:625
Well:81
Vector:pFlc-1
Associated Gene/TranscriptRpL21-RA
Protein status:RE62581.pep: gold
Preliminary Size:639
Sequenced Size:629

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12775 2001-12-17 Blastp of sequenced clone
CG12775 2002-01-01 Sim4 clustering to Release 2
CG12775 2003-01-01 Sim4 clustering to Release 3
RpL21 2008-04-29 Release 5.5 accounting
RpL21 2008-08-15 Release 5.9 accounting
RpL21 2008-12-18 5.12 accounting

Clone Sequence Records

RE62581.complete Sequence

629 bp (629 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071556

> RE62581.complete
ATCTTTCTTTCTTTTCTCAACTATACGACCGCGTGGACGGGATTATAAAT
AAAAATGACCAACTCAAAGGGCTATCGTCGCGGCACACGGGACATGTTTT
CCCGTCCCTTCCGAAAGCATGGAGTTATTCCGTTGTCCACATACATGCGG
GTTTTCAAGATCGGCGACATCGTTGACATTAAGGGACATGGTGCTGTACA
GAAGGGTTTGCCCTATAAGGCATATCATGGCAAAACCGGGCGCATATTCA
ATGTGACTCAGCACGCCGTTGGTGTAATAGTAAACAAACGCGTAAGAGGC
AAAATCCTTGCTAAGCGGGTCAATGTGCGCATTGAGCACATCCACCACTC
CAAGTGCCGCGAAGATTTTTTGCGCCGCGTAAAGGAAAATGAGCGATTGC
TGAAGGAGGCGAAGGAAAAGGGACAATGGGTCAGTCTGAAGCGCCAGCCG
GAACAGCCGAAGAAGGCGCACTTTGTTAAGAAACTTGAAGAACCGATTGC
TCTGGCCCCGATTCCATACGAATTCATTGCCTAAAGGCATTTTACTGCTC
GGAAATTGTACGGAATGAAATAATATTTGATATAATTTCAGTAAACAAAA
AAAATGTGCCCAATAAAAAAAAAAAAAAA

RE62581.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:22
Subject Length Description Subject Range Query Range Score Percent Strand
RpL21-RA 826 RpL21-RA 44..662 1..619 3080 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 22245678..22246253 614..39 2880 100 Minus
chr2L 23010047 chr2L 22246327..22246365 39..1 195 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:08:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:53:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22247141..22247721 619..39 2890 99.8 Minus
2L 23513712 2L 22247795..22247833 39..1 195 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22247141..22247721 619..39 2890 99.8 Minus
2L 23513712 2L 22247795..22247833 39..1 195 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:53:34 has no hits.

RE62581.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:54:29 Download gff for RE62581.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 22245678..22246253 39..614 100 <- Minus
chr2L 22246328..22246365 1..38 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:29:11 Download gff for RE62581.complete
Subject Subject Range Query Range Percent Splice Strand
RpL21-RA 1..480 55..534 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:59:22 Download gff for RE62581.complete
Subject Subject Range Query Range Percent Splice Strand
RpL21-RA 1..480 55..534 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:23:39 Download gff for RE62581.complete
Subject Subject Range Query Range Percent Splice Strand
RpL21-RA 1..480 55..534 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:24:06 Download gff for RE62581.complete
Subject Subject Range Query Range Percent Splice Strand
RpL21-RA 1..480 55..534 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:23:58 Download gff for RE62581.complete
Subject Subject Range Query Range Percent Splice Strand
RpL21-RA 1..480 55..534 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:24:55 Download gff for RE62581.complete
Subject Subject Range Query Range Percent Splice Strand
RpL21-RA 1..614 1..614 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:59:22 Download gff for RE62581.complete
Subject Subject Range Query Range Percent Splice Strand
RpL21-RA 1..614 1..614 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:23:39 Download gff for RE62581.complete
Subject Subject Range Query Range Percent Splice Strand
RpL21-RA 1..614 1..614 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:24:06 Download gff for RE62581.complete
Subject Subject Range Query Range Percent Splice Strand
RpL21-RA 1..614 1..614 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:23:58 Download gff for RE62581.complete
Subject Subject Range Query Range Percent Splice Strand
RpL21-RA 1..614 1..614 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:54:29 Download gff for RE62581.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22247146..22247721 39..614 100 <- Minus
2L 22247796..22247833 1..38 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:54:29 Download gff for RE62581.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22247146..22247721 39..614 100 <- Minus
2L 22247796..22247833 1..38 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:54:29 Download gff for RE62581.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22247146..22247721 39..614 100 <- Minus
2L 22247796..22247833 1..38 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:39 Download gff for RE62581.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22247146..22247721 39..614 100 <- Minus
arm_2L 22247796..22247833 1..38 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:59:16 Download gff for RE62581.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22247146..22247721 39..614 100 <- Minus
2L 22247796..22247833 1..38 100   Minus

RE62581.pep Sequence

Translation from 54 to 533

> RE62581.pep
MTNSKGYRRGTRDMFSRPFRKHGVIPLSTYMRVFKIGDIVDIKGHGAVQK
GLPYKAYHGKTGRIFNVTQHAVGVIVNKRVRGKILAKRVNVRIEHIHHSK
CREDFLRRVKENERLLKEAKEKGQWVSLKRQPEQPKKAHFVKKLEEPIAL
APIPYEFIA*

RE62581.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22757-PA 159 GF22757-PA 1..159 1..159 831 99.4 Plus
Dana\GF22685-PA 97 GF22685-PA 2..97 56..159 447 87.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21369-PA 159 GG21369-PA 1..159 1..159 834 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13288-PA 159 GH13288-PA 1..159 1..159 789 93.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
RpL21-PC 159 CG12775-PC 1..159 1..159 834 100 Plus
RpL21-PB 159 CG12775-PB 1..159 1..159 834 100 Plus
RpL21-PA 159 CG12775-PA 1..159 1..159 834 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17481-PA 159 GI17481-PA 1..159 1..159 796 93.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21175-PA 159 GL21175-PA 1..159 1..159 828 98.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11806-PB 159 GA11806-PB 1..159 1..159 828 98.7 Plus
Dpse\GA11806-PA 159 GA11806-PA 1..159 1..159 828 98.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18795-PA 159 GM18795-PA 1..159 1..159 834 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24352-PA 159 GD24352-PA 1..159 1..159 834 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15013-PA 159 GJ15013-PA 1..159 1..159 809 94.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19074-PA 159 GK19074-PA 1..159 1..159 825 98.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12955-PA 159 GE12955-PA 1..159 1..159 826 99.4 Plus

RE62581.hyp Sequence

Translation from 54 to 533

> RE62581.hyp
MTNSKGYRRGTRDMFSRPFRKHGVIPLSTYMRVFKIGDIVDIKGHGAVQK
GLPYKAYHGKTGRIFNVTQHAVGVIVNKRVRGKILAKRVNVRIEHIHHSK
CREDFLRRVKENERLLKEAKEKGQWVSLKRQPEQPKKAHFVKKLEEPIAL
APIPYEFIA*

RE62581.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
RpL21-PC 159 CG12775-PC 1..159 1..159 834 100 Plus
RpL21-PB 159 CG12775-PB 1..159 1..159 834 100 Plus
RpL21-PA 159 CG12775-PA 1..159 1..159 834 100 Plus