Clone RE62711 Report

Search the DGRC for RE62711

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:627
Well:11
Vector:pFlc-1
Associated Gene/TranscriptCG32442-RA
Protein status:RE62711.pep: gold
Sequenced Size:923

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32442 2001-12-14 Blastp of sequenced clone
CG7186 2002-01-01 Sim4 clustering to Release 2
CG32442 2008-04-29 Release 5.5 accounting
CG32442 2008-08-15 Release 5.9 accounting
CG32442 2008-12-18 5.12 accounting

Clone Sequence Records

RE62711.complete Sequence

923 bp (923 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071557

> RE62711.complete
AATCGGCTGATAGATCCAAGTGTTTGTTTTTCGGGCAGCCCAATGAAACT
TTAAATGGATGCAAAATGTCCGAAAAGAAGCGATTTGTGTGCGTTAATTG
TGGACACAGAGTAAAAGAACTGTTCAAGAAATACAGCAATACTATGAAAA
CCACGCAATGCGACAACTGTCACCAAATCACGGATAAATACATTGAGTTC
GAGGAGTTTATCATATTAATAGATGCACTGCTATTAGATTCGTGCGCCTT
CCGGCACATTATATACAATGGCGACTTTAAGCTCTACTGGAAGGTTTCGC
TGGTGGTGCTGCTCCTGGAATCCTTTGCGCTGTGCCGCCAAAAACTGCCC
GACCCTCCGAATGCCTCTTTGCATGTCCACGAAAAGGGCTTTTACACATA
TACCCTTCAAAACATGGGAGATTACATGTTCATGACTCTATTGCTGCTAA
TAATCACCGCCACTCTGAGTATTGATTGGATGCAGAAAATAGGCTTTCGA
AATTTTTCTTTAATTATACTCAAAGTGGTGCTGATATCCAACCTGTCCAA
GTTCTTCCTTCTGCCCATTTTGGTGTGGCGAAATAACACGACCGTTTTTG
GCCGGAACTTGCACCATCTTCTGGTCATGGGACATCACCTCTGCTCCCTG
GTCCTCGCCTACCAGGCAGTCGGAGCCACTAGGAAGAACCTTCGATGGTG
GGCTCTAACTTTGGTTGTTATAGCTTTCGCCTTCAAGGAAACCGCGAGGC
AGTTTGTATCACTAGTGGTGGAGGACAATTGATTATAGAAGGCTGAAAAT
AGTAAACCAAAATTTTATTTAACAAAAATATAACTCTTCAAAGACAGCAC
TTTGCTCTGAAATATGTGACATGACCTAAAATAAAAAAGCAAGCTAGTTT
TTTACTCAAAAAAAAAAAAAAAA

RE62711.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG32442-RA 1143 CG32442-RA 207..1116 1..910 4535 99.8 Plus
CG32442-RB 920 CG32442-RB 293..920 280..907 3140 100 Plus
CG32442-RC 966 CG32442-RC 351..966 292..907 3080 100 Plus
CG32442-RB 920 CG32442-RB 6..286 1..281 1390 99.6 Plus
CG32442-RC 966 CG32442-RC 64..344 1..281 1390 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21517153..21517641 907..419 2445 100 Minus
chr3L 24539361 chr3L 21518080..21518241 162..1 795 99.4 Minus
chr3L 24539361 chr3L 21517705..21517845 420..280 705 100 Minus
chr3L 24539361 chr3L 21517901..21518020 281..162 600 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:08:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21528215..21528706 910..419 2460 100 Minus
3L 28110227 3L 21529145..21529306 162..1 795 99.4 Minus
3L 28110227 3L 21528770..21528910 420..280 705 100 Minus
3L 28110227 3L 21528966..21529085 281..162 600 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21521315..21521806 910..419 2460 100 Minus
3L 28103327 3L 21522245..21522406 162..1 795 99.3 Minus
3L 28103327 3L 21521870..21522010 420..280 705 100 Minus
3L 28103327 3L 21522066..21522185 281..162 600 100 Minus
Blast to na_te.dros performed 2019-03-15 20:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 2747..2820 734..807 108 64 Plus

RE62711.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:09:02 Download gff for RE62711.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21517153..21517639 421..907 100 <- Minus
chr3L 21517705..21517843 282..420 100 <- Minus
chr3L 21517901..21518020 162..281 100 <- Minus
chr3L 21518081..21518241 1..161 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:29:18 Download gff for RE62711.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RA 1..717 66..782 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:08:00 Download gff for RE62711.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RA 1..717 66..782 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:03:16 Download gff for RE62711.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RA 1..717 66..782 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:32:18 Download gff for RE62711.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RA 1..717 66..782 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:29:30 Download gff for RE62711.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RA 1..717 66..782 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:36:47 Download gff for RE62711.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RA 1..907 1..907 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:00 Download gff for RE62711.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RA 1..907 1..907 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:03:16 Download gff for RE62711.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RA 28..934 1..907 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:18 Download gff for RE62711.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RA 1..907 1..907 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:29:30 Download gff for RE62711.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RA 28..934 1..907 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:09:02 Download gff for RE62711.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21528218..21528704 421..907 100 <- Minus
3L 21528770..21528908 282..420 100 <- Minus
3L 21528966..21529085 162..281 100 <- Minus
3L 21529146..21529306 1..161 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:09:02 Download gff for RE62711.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21528218..21528704 421..907 100 <- Minus
3L 21528770..21528908 282..420 100 <- Minus
3L 21528966..21529085 162..281 100 <- Minus
3L 21529146..21529306 1..161 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:09:02 Download gff for RE62711.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21528218..21528704 421..907 100 <- Minus
3L 21528770..21528908 282..420 100 <- Minus
3L 21528966..21529085 162..281 100 <- Minus
3L 21529146..21529306 1..161 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:03:16 Download gff for RE62711.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21521318..21521804 421..907 100 <- Minus
arm_3L 21521870..21522008 282..420 100 <- Minus
arm_3L 21522066..21522185 162..281 100 <- Minus
arm_3L 21522246..21522406 1..161 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:09:09 Download gff for RE62711.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21522066..21522185 162..281 100 <- Minus
3L 21522246..21522406 1..161 99   Minus
3L 21521318..21521804 421..907 100 <- Minus
3L 21521870..21522008 282..420 100 <- Minus

RE62711.hyp Sequence

Translation from 2 to 781

> RE62711.hyp
SADRSKCLFFGQPNETLNGCKMSEKKRFVCVNCGHRVKELFKKYSNTMKT
TQCDNCHQITDKYIEFEEFIILIDALLLDSCAFRHIIYNGDFKLYWKVSL
VVLLLESFALCRQKLPDPPNASLHVHEKGFYTYTLQNMGDYMFMTLLLLI
ITATLSIDWMQKIGFRNFSLIILKVVLISNLSKFFLLPILVWRNNTTVFG
RNLHHLLVMGHHLCSLVLAYQAVGATRKNLRWWALTLVVIAFAFKETARQ
FVSLVVEDN*

RE62711.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG32442-PA 238 CG32442-PA 1..238 22..259 1251 100 Plus
CG32442-PC 121 CG32442-PC 1..73 22..94 393 98.6 Plus
CG32442-PB 125 CG32442-PB 1..73 22..94 393 98.6 Plus

RE62711.pep Sequence

Translation from 65 to 781

> RE62711.pep
MSEKKRFVCVNCGHRVKELFKKYSNTMKTTQCDNCHQITDKYIEFEEFII
LIDALLLDSCAFRHIIYNGDFKLYWKVSLVVLLLESFALCRQKLPDPPNA
SLHVHEKGFYTYTLQNMGDYMFMTLLLLIITATLSIDWMQKIGFRNFSLI
ILKVVLISNLSKFFLLPILVWRNNTTVFGRNLHHLLVMGHHLCSLVLAYQ
AVGATRKNLRWWALTLVVIAFAFKETARQFVSLVVEDN*

RE62711.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10706-PA 240 GF10706-PA 1..238 1..238 945 76.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13227-PA 239 GG13227-PA 3..237 4..238 1124 93.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16742-PA 240 GH16742-PA 7..236 5..236 721 63.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
Arv1-PA 238 CG32442-PA 1..238 1..238 1251 100 Plus
Arv1-PC 121 CG32442-PC 1..73 1..73 393 98.6 Plus
Arv1-PB 125 CG32442-PB 1..73 1..73 393 98.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13467-PA 240 GI13467-PA 6..236 4..236 717 64.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11902-PA 206 GL11902-PA 1..204 33..236 775 73 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:58:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16907-PA 238 GA16907-PA 1..236 1..236 904 72.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:58:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22132-PA 240 GM22132-PA 1..238 1..238 1161 95 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12111-PA 240 GD12111-PA 1..238 1..238 1231 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11830-PA 240 GJ11830-PA 6..236 4..236 734 63.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17511-PA 240 GK17511-PA 7..237 5..237 806 69.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22323-PA 240 GE22323-PA 1..238 1..238 1153 94.1 Plus
Dyak\GE23005-PA 141 GE23005-PA 1..141 1..141 661 93.6 Plus