Clone RE62842 Report

Search the DGRC for RE62842

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:628
Well:42
Vector:pFlc-1
Associated Gene/TranscriptTrs20-RA
Protein status:RE62842.pep: gold
Preliminary Size:477
Sequenced Size:562

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5161 2001-12-14 Blastp of sequenced clone
CG5161 2002-01-01 Sim4 clustering to Release 2
CG5161 2003-01-01 Sim4 clustering to Release 3
CG5161 2008-04-29 Release 5.5 accounting
CG5161 2008-08-15 Release 5.9 accounting
CG5161 2008-12-18 5.12 accounting

Clone Sequence Records

RE62842.complete Sequence

562 bp (562 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071561

> RE62842.complete
ACTGTTTTGGTTTTCGTGAAAATGTCCACATACTACTTTGTTATTGTGGG
TCAAAATGATAATCCCATTTACGAGAAGGAATTCAGCACCGTGAACAAGG
AACTAAGGAAAGAGGACCACAGGCACCTCACCCAGTTTATTGCCCATGCC
GCCTTGGATTTGGTGGATGAGCACAAATGGAAGACGGCCAATATGCAGCT
GAAATCCATTGATAGATTCAATCAGTGGTTTGTTTCGGCCTTCATCACAG
CCAGCCAAATACGATTCATCATCGTTCATGACAACAAAAACGACGAGGGA
ATCAAGAACTTCTTTAACGAGATGTATGACACGTATATCAAAAACTCCAT
GAATGCCTTCTATCGCATCAACACACCCATTAAATCTCCGATGTTTGAGA
AGAAGTCGGAGATCTTTGGTCGGAAGTATTTGTTATCATAAATTTGTTAA
AACCTGTAGCCATTAAGTAATTGTGTAATATAAAACTTGAAATAATTTAA
AAGCATAACTTTACCCTTTCTTATACAGTTGAGAAGACCCGAAACCAAAA
AAAAAAAAAAAA

RE62842.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG5161-RA 723 CG5161-RA 123..670 1..548 2740 100 Plus
CG5161.a 433 CG5161.a 42..364 1..323 1615 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16120766..16121204 546..108 2180 99.8 Minus
chr3L 24539361 chr3L 16121261..16121368 108..1 540 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:08:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:34:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16130999..16131439 548..108 2205 100 Minus
3L 28110227 3L 16131496..16131603 108..1 540 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16124099..16124539 548..108 2205 100 Minus
3L 28103327 3L 16124596..16124703 108..1 540 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:34:40 has no hits.

RE62842.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:35:43 Download gff for RE62842.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16120766..16121203 109..546 99 <- Minus
chr3L 16121261..16121368 1..108 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:29:23 Download gff for RE62842.complete
Subject Subject Range Query Range Percent Splice Strand
CG5161-RA 1..420 22..441 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:57:43 Download gff for RE62842.complete
Subject Subject Range Query Range Percent Splice Strand
CG5161-RA 1..420 22..441 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:05:26 Download gff for RE62842.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)72Dh-RA 1..420 22..441 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:48:33 Download gff for RE62842.complete
Subject Subject Range Query Range Percent Splice Strand
CG5161-RA 1..420 22..441 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:42:53 Download gff for RE62842.complete
Subject Subject Range Query Range Percent Splice Strand
Trs20-RA 1..420 22..441 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:13:59 Download gff for RE62842.complete
Subject Subject Range Query Range Percent Splice Strand
CG5161-RA 1..546 1..546 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:57:42 Download gff for RE62842.complete
Subject Subject Range Query Range Percent Splice Strand
CG5161-RA 1..546 1..546 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:05:26 Download gff for RE62842.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)72Dh-RA 30..575 1..546 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:48:33 Download gff for RE62842.complete
Subject Subject Range Query Range Percent Splice Strand
CG5161-RA 1..546 1..546 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:42:53 Download gff for RE62842.complete
Subject Subject Range Query Range Percent Splice Strand
Trs20-RA 30..575 1..546 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:35:43 Download gff for RE62842.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16131001..16131438 109..546 100 <- Minus
3L 16131496..16131603 1..108 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:35:43 Download gff for RE62842.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16131001..16131438 109..546 100 <- Minus
3L 16131496..16131603 1..108 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:35:43 Download gff for RE62842.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16131001..16131438 109..546 100 <- Minus
3L 16131496..16131603 1..108 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:05:26 Download gff for RE62842.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16124101..16124538 109..546 100 <- Minus
arm_3L 16124596..16124703 1..108 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:19:56 Download gff for RE62842.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16124101..16124538 109..546 100 <- Minus
3L 16124596..16124703 1..108 100   Minus

RE62842.hyp Sequence

Translation from 0 to 440

> RE62842.hyp
TVLVFVKMSTYYFVIVGQNDNPIYEKEFSTVNKELRKEDHRHLTQFIAHA
ALDLVDEHKWKTANMQLKSIDRFNQWFVSAFITASQIRFIIVHDNKNDEG
IKNFFNEMYDTYIKNSMNAFYRINTPIKSPMFEKKSEIFGRKYLLS*

RE62842.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
Trs20-PA 139 CG5161-PA 1..139 8..146 735 100 Plus

RE62842.pep Sequence

Translation from 21 to 440

> RE62842.pep
MSTYYFVIVGQNDNPIYEKEFSTVNKELRKEDHRHLTQFIAHAALDLVDE
HKWKTANMQLKSIDRFNQWFVSAFITASQIRFIIVHDNKNDEGIKNFFNE
MYDTYIKNSMNAFYRINTPIKSPMFEKKSEIFGRKYLLS*

RE62842.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10320-PA 139 GF10320-PA 1..139 1..139 703 94.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13494-PA 139 GG13494-PA 1..139 1..139 720 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15035-PA 139 GH15035-PA 1..139 1..139 697 93.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
Trs20-PA 139 CG5161-PA 1..139 1..139 735 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16687-PA 139 GI16687-PA 1..139 1..139 691 93.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18033-PA 139 GL18033-PA 1..139 1..139 696 93.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18699-PA 139 GA18699-PA 1..139 1..139 696 93.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24443-PA 139 GM24443-PA 1..139 1..139 728 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12512-PA 139 GD12512-PA 1..139 1..139 732 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:51:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12939-PA 139 GJ12939-PA 1..139 1..139 712 96.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:51:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17335-PA 139 GK17335-PA 1..139 1..139 709 95.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:51:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22808-PA 139 GE22808-PA 1..139 1..139 720 97.8 Plus
Dyak\GE22585-PA 139 GE22585-PA 1..139 1..139 720 97.8 Plus