Clone RE63021 Report

Search the DGRC for RE63021

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:630
Well:21
Vector:pFlc-1
Associated Gene/TranscriptRap2l-RA
Protein status:RE63021.pep: gold
Sequenced Size:1016

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3204 2004-03-31 Blastp of sequenced clone
Rap2l 2008-04-29 Release 5.5 accounting
Rap2l 2008-08-15 Release 5.9 accounting
Rap2l 2008-12-18 5.12 accounting

Clone Sequence Records

RE63021.complete Sequence

1016 bp (1016 high quality bases) assembled on 2004-03-31

GenBank Submission: BT012453

> RE63021.complete
GTCGTGTGTATCTGCCCCTAACGTTTTTGTTCTAAAACCATTATTTCATT
TCTTCTATACATCGTTCCATTTTCCCATAAGTGTCAGTGTCATCATTTAT
CAATTATCATTTGATTATTATATTTTACAATATAATATGTGTTTAAGAAA
AGCCAAAAACGCTTCCTGCTGAGGACGAGGCACAAACAGAGCGCAGTTTT
GTCACCGAACTTCCGTGCATTACGTGCGAATCGAAACGCAATGTCAACCC
ATACATAATATTTTGCTTTGTAAACGGTTTTTGAGTTGAAATACATACAC
ACAGTGGTGTTAAATATAAACACGTACAGAAGACTCATTTGCATCTATAT
TGCACGCATCGAATAACACAAAAAGCTGATTTAACAATGCGCGAATTCAA
AGTTGTTGTGCTCGGGTCGGGGGGAGTTGGTAAATCGGCCCTTACAGTGC
AATTCGTCTCGGGATGCTTTATTGAAAAGTACGATCCCACCATCGAGGAC
TTCTACCGCAAGGAAATCGAGGTGGACAGCTCGCCGTGCGTCTTGGAAAT
ATTGGACACCGCGGGCACAGAGCAATTCGCATCCATGAGAGATCTCTACA
TTAAAAATGGTCATGGTTTTATTGTAATGTATTCACTTACGAACCATCAA
ACATTTCAGGATATTTCTAGTATGAAAAATGTGATCACTCGAGTGAAAGG
AAGTCAGCCAGCACCCATCCTACTAGTCGCGAACAAATTCGATTTAGATT
GCCAAAGAGAGGTATCCACCGCTGAAGGTAATGCCTTGGCACAACTGTGG
GACTGTCCATTTATCGAGGCATCTGCAAAGGATCGGATAAACGTAAACGA
AGTATTCGCCACCATCGTTCGAGAGATGAATTTGACGCAAGAGAATCGGC
AAAAAAAAAATTACTGTTGTTGTACGCTTTTATAGAAATTTTGTAAAATT
GTAAGATTATTATAGTTAAAAATAAAATTACTAATATTTAATAGATAACC
AAAAAAAAAAAAAAAA

RE63021.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
Rap2l-RA 1022 Rap2l-RA 1..1004 1..1004 5005 99.9 Plus
Rap2l-RB 2353 Rap2l-RB 1..523 1..523 2615 100 Plus
Rap2l-RB 2353 Rap2l-RB 2129..2352 776..999 1120 100 Plus
Rap2l-RB 2353 Rap2l-RB 1680..1820 520..660 705 100 Plus
Rap2l-RB 2353 Rap2l-RB 1938..2061 657..780 620 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19949076..19949598 1..523 2600 99.8 Plus
chr2R 21145070 chr2R 19951198..19951421 776..999 1120 100 Plus
chr2R 21145070 chr2R 19950749..19950889 520..660 705 100 Plus
chr2R 21145070 chr2R 19951007..19951130 657..780 620 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:08:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24063053..24063575 1..523 2615 100 Plus
2R 25286936 2R 24065181..24065409 776..1004 1130 99.6 Plus
2R 25286936 2R 24064732..24064872 520..660 705 100 Plus
2R 25286936 2R 24064990..24065113 657..780 620 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24064252..24064774 1..523 2615 100 Plus
2R 25260384 2R 24066380..24066608 776..1004 1130 99.5 Plus
2R 25260384 2R 24065931..24066071 520..660 705 100 Plus
2R 25260384 2R 24066189..24066312 657..780 620 100 Plus
Blast to na_te.dros performed 2019-03-16 23:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 1442..1499 932..990 139 72.9 Plus
hobo 2959 hobo DMHFL1 2959bp Derived from M69216 (g157606) (Rel. 41, Last updated, Version 3). 2400..2474 920..997 122 67.5 Plus
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 1418..1557 849..993 117 58.2 Plus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1014..1066 944..996 112 67.9 Plus

RE63021.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:30:03 Download gff for RE63021.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19951200..19951372 778..950 100 -> Plus
chr2R 19949076..19949596 1..521 99 -> Plus
chr2R 19950751..19950888 522..659 100 -> Plus
chr2R 19951010..19951127 660..777 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:29:30 Download gff for RE63021.complete
Subject Subject Range Query Range Percent Splice Strand
Rap2l-RA 1..549 387..935 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:37:39 Download gff for RE63021.complete
Subject Subject Range Query Range Percent Splice Strand
Rap2l-RA 1..549 387..935 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:20:59 Download gff for RE63021.complete
Subject Subject Range Query Range Percent Splice Strand
Rap2l-RA 1..549 387..935 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:21:25 Download gff for RE63021.complete
Subject Subject Range Query Range Percent Splice Strand
Rap2l-RA 1..549 387..935 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:50:58 Download gff for RE63021.complete
Subject Subject Range Query Range Percent Splice Strand
Rap2l-RA 1..549 387..935 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:45:23 Download gff for RE63021.complete
Subject Subject Range Query Range Percent Splice Strand
Rap2l-RA 1..999 1..1000 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:37:39 Download gff for RE63021.complete
Subject Subject Range Query Range Percent Splice Strand
Rap2l-RA 1..999 1..1000 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:20:59 Download gff for RE63021.complete
Subject Subject Range Query Range Percent Splice Strand
Rap2l-RA 3..1001 1..1000 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:21:25 Download gff for RE63021.complete
Subject Subject Range Query Range Percent Splice Strand
Rap2l-RA 1..999 1..1000 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:50:58 Download gff for RE63021.complete
Subject Subject Range Query Range Percent Splice Strand
Rap2l-RA 3..1001 1..1000 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:30:03 Download gff for RE63021.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24063053..24063573 1..521 100 -> Plus
2R 24064734..24064871 522..659 100 -> Plus
2R 24064993..24065110 660..777 100 -> Plus
2R 24065183..24065404 778..1000 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:30:03 Download gff for RE63021.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24063053..24063573 1..521 100 -> Plus
2R 24064734..24064871 522..659 100 -> Plus
2R 24064993..24065110 660..777 100 -> Plus
2R 24065183..24065404 778..1000 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:30:03 Download gff for RE63021.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24063053..24063573 1..521 100 -> Plus
2R 24064734..24064871 522..659 100 -> Plus
2R 24064993..24065110 660..777 100 -> Plus
2R 24065183..24065404 778..1000 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:20:59 Download gff for RE63021.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19950576..19951096 1..521 100 -> Plus
arm_2R 19952257..19952394 522..659 100 -> Plus
arm_2R 19952516..19952633 660..777 100 -> Plus
arm_2R 19952706..19952927 778..1000 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:58:51 Download gff for RE63021.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24064270..24064790 1..521 100 -> Plus
2R 24065951..24066088 522..659 100 -> Plus
2R 24066210..24066327 660..777 100 -> Plus
2R 24066400..24066621 778..1000 99   Plus

RE63021.pep Sequence

Translation from 386 to 934

> RE63021.pep
MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSP
CVLEILDTAGTEQFASMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVI
TRVKGSQPAPILLVANKFDLDCQREVSTAEGNALAQLWDCPFIEASAKDR
INVNEVFATIVREMNLTQENRQKKNYCCCTLL*

RE63021.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11365-PA 182 GF11365-PA 1..182 1..182 978 100 Plus
Dana\GF24954-PA 184 GF24954-PA 1..165 1..165 531 58.2 Plus
Dana\GF13570-PA 257 GF13570-PA 50..213 1..164 447 49.4 Plus
Dana\GF22303-PA 235 GF22303-PA 13..201 5..182 398 42.3 Plus
Dana\GF16057-PA 189 GF16057-PA 1..173 1..174 380 42.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22932-PA 182 GG22932-PA 1..182 1..182 978 100 Plus
Dere\GG14553-PA 184 GG14553-PA 1..165 1..165 528 58.2 Plus
Dere\GG22302-PA 264 GG22302-PA 57..220 1..164 447 49.4 Plus
Dere\GG18572-PA 235 GG18572-PA 13..201 5..182 395 42.3 Plus
Dere\GG17366-PA 189 GG17366-PA 1..173 1..174 380 42.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20176-PA 182 GH20176-PA 1..182 1..182 956 97.8 Plus
Dgri\GH15039-PA 184 GH15039-PA 1..165 1..165 532 58.2 Plus
Dgri\GH19819-PA 265 GH19819-PA 60..223 1..164 445 48.8 Plus
Dgri\GH24739-PA 234 GH24739-PA 13..201 5..182 401 42.9 Plus
Dgri\GH19394-PA 189 GH19394-PA 1..173 1..174 380 43.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:48
Subject Length Description Subject Range Query Range Score Percent Strand
Rap2l-PA 182 CG3204-PA 1..182 1..182 945 100 Plus
Rap2l-PD 116 CG3204-PD 1..116 67..182 609 100 Plus
Rap2l-PC 116 CG3204-PC 1..116 67..182 609 100 Plus
Rap1-PC 184 CG1956-PC 1..184 1..182 523 56 Plus
Rap1-PB 184 CG1956-PB 1..184 1..182 523 56 Plus
Rap1-PA 184 CG1956-PA 1..184 1..182 523 56 Plus
Ric-PB 264 CG8418-PB 57..220 1..164 434 49.4 Plus
Ric-PA 264 CG8418-PA 57..220 1..164 434 49.4 Plus
Ras85D-PA 189 CG9375-PA 1..173 1..174 418 42.5 Plus
Rala-PB 197 CG2849-PB 13..197 5..182 402 43.2 Plus
Ras64B-PA 192 CG1167-PA 3..192 1..181 396 40.5 Plus
Rala-PC 201 CG2849-PC 13..201 5..182 387 42.3 Plus
Rala-PA 201 CG2849-PA 13..201 5..182 387 42.3 Plus
CG8500-PB 233 CG8500-PB 18..201 3..174 344 40.2 Plus
CG8500-PA 233 CG8500-PA 18..201 3..174 344 40.2 Plus
Rheb-PB 182 CG1081-PB 4..179 2..177 316 34.7 Plus
Rheb-PA 182 CG1081-PA 4..179 2..177 316 34.7 Plus
CG13375-PC 277 CG13375-PC 20..187 5..167 273 33.9 Plus
CG13375-PB 306 CG13375-PB 49..216 5..167 273 33.9 Plus
CG13375-PA 306 CG13375-PA 49..216 5..167 273 33.9 Plus
Rab8-PC 207 CG8287-PC 9..180 4..175 243 33.1 Plus
Rab8-PA 207 CG8287-PA 9..180 4..175 243 33.1 Plus
Rab1-PA 205 CG3320-PA 12..172 4..164 242 35.2 Plus
CG8519-PA 207 CG8519-PA 13..183 1..175 237 33.7 Plus
Rab6-PB 208 CG6601-PB 10..169 1..160 237 36.6 Plus
Rab6-PA 208 CG6601-PA 10..169 1..160 237 36.6 Plus
Rab2-PB 213 CG3269-PB 7..167 4..164 237 35.2 Plus
Rab2-PA 213 CG3269-PA 7..167 4..164 237 35.2 Plus
Rab26-PE 410 CG34410-PE 214..375 5..164 235 33.1 Plus
Rab26-PD 410 CG34410-PD 214..375 5..164 235 33.1 Plus
Rab26-PC 410 CG34410-PC 214..375 5..164 235 33.1 Plus
Rab19-PB 219 CG7062-PP3-RB 22..184 4..164 232 33.5 Plus
Rab19-PA 219 CG7062-PA 22..184 4..164 232 33.5 Plus
Rab35-PB 201 CG9575-PB 9..183 4..175 231 32.8 Plus
Rab35-PD 201 CG9575-PD 9..183 4..175 231 32.8 Plus
Rab35-PA 201 CG9575-PA 9..183 4..175 231 32.8 Plus
Rab9Fb-PA 214 CG32670-PA 8..161 4..157 231 36.8 Plus
RabX4-PA 213 CG31118-PA 9..177 4..171 230 31.6 Plus
Rab30-PD 223 CG9100-PD 8..167 4..164 228 36.4 Plus
Rab30-PC 223 CG9100-PC 8..167 4..164 228 36.4 Plus
Rab30-PB 223 CG9100-PB 8..167 4..164 228 36.4 Plus
Rab30-PA 223 CG9100-PA 8..167 4..164 228 36.4 Plus
Rab23-PA 268 CG2108-PA 39..190 5..157 228 34.4 Plus
RabX2-PA 195 CG2885-PA 8..168 4..164 226 34 Plus
Rab3-PB 220 CG7576-PB 22..179 4..161 222 32.3 Plus
Rab3-PA 220 CG7576-PA 22..179 4..161 222 32.3 Plus
Rab39-PB 218 CG12156-PB 9..175 3..164 221 33.9 Plus
Rab39-PA 218 CG12156-PA 9..175 3..164 221 33.9 Plus
CG30158-PA 280 CG30158-PA 4..170 1..161 221 32.7 Plus
CG8641-PB 434 CG8641-PB 167..346 4..169 221 29.4 Plus
CG8641-PA 434 CG8641-PA 167..346 4..169 221 29.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20698-PA 182 GI20698-PA 1..182 1..182 958 97.8 Plus
Dmoj\GI16691-PA 184 GI16691-PA 1..165 1..165 531 58.2 Plus
Dmoj\GI20407-PA 267 GI20407-PA 60..223 1..164 448 49.4 Plus
Dmoj\GI14784-PA 234 GI14784-PA 13..201 5..182 395 42.3 Plus
Dmoj\GI22599-PA 181 GI22599-PA 1..165 1..174 368 42.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11660-PA 182 GL11660-PA 1..182 1..182 978 100 Plus
Dper\GL19979-PA 262 GL19979-PA 57..227 1..171 451 47.4 Plus
Dper\GL22227-PA 189 GL22227-PA 1..173 1..174 378 42.5 Plus
Dper\GL12826-PA 174 GL12826-PA 11..157 16..162 353 44.9 Plus
Dper\GL21674-PA 182 GL21674-PA 4..182 2..180 326 34.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24803-PA 182 GA24803-PA 1..182 1..182 978 100 Plus
Dpse\GA15150-PA 184 GA15150-PA 1..165 1..165 532 58.2 Plus
Dpse\GA21063-PA 262 GA21063-PA 57..227 1..171 451 47.4 Plus
Dpse\GA15484-PA 201 GA15484-PA 13..201 5..182 396 42.3 Plus
Dpse\GA21740-PA 189 GA21740-PA 1..173 1..174 378 42.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18299-PA 182 GM18299-PA 1..182 1..182 978 100 Plus
Dsec\GM14161-PA 184 GM14161-PA 1..165 1..165 528 58.2 Plus
Dsec\GM20091-PA 264 GM20091-PA 57..220 1..164 447 49.4 Plus
Dsec\GM12716-PA 235 GM12716-PA 13..201 5..182 395 42.3 Plus
Dsec\GM26252-PA 189 GM26252-PA 1..173 1..174 380 42.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11831-PA 182 GD11831-PA 1..182 1..182 978 100 Plus
Dsim\R-PA 184 GD13432-PA 1..165 1..165 528 58.2 Plus
Dsim\GD25569-PA 264 GD25569-PA 57..220 1..164 447 49.4 Plus
Dsim\GD16321-PA 235 GD16321-PA 13..201 5..182 395 42.3 Plus
Dsim\Ras85D-PA 189 GD20791-PA 1..173 1..174 380 42.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20446-PA 182 GJ20446-PA 1..182 1..182 963 98.4 Plus
Dvir\GJ12943-PA 184 GJ12943-PA 1..165 1..165 531 58.2 Plus
Dvir\GJ20079-PA 267 GJ20079-PA 60..223 1..164 449 50 Plus
Dvir\GJ18826-PA 234 GJ18826-PA 13..201 5..182 395 42.3 Plus
Dvir\Ras1-PA 189 GJ23844-PA 1..173 1..174 382 43.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21923-PA 159 GK21923-PA 1..156 1..156 825 98.1 Plus
Dwil\GK20561-PA 184 GK20561-PA 1..165 1..165 532 58.2 Plus
Dwil\GK24932-PA 235 GK24932-PA 13..201 5..182 396 42.3 Plus
Dwil\GK13838-PA 189 GK13838-PA 1..173 1..174 380 43.1 Plus
Dwil\GK12838-PA 192 GK12838-PA 3..164 1..162 361 45.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14369-PA 182 GE14369-PA 1..182 1..182 978 100 Plus
Dyak\GE20907-PA 184 GE20907-PA 1..165 1..165 528 58.2 Plus
Dyak\GE14098-PA 264 GE14098-PA 57..220 1..164 447 49.4 Plus
Dyak\GE16885-PA 235 GE16885-PA 13..201 5..182 395 42.3 Plus
Dyak\GE24771-PA 189 GE24771-PA 1..173 1..174 380 42.5 Plus

RE63021.hyp Sequence

Translation from 386 to 934

> RE63021.hyp
MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSP
CVLEILDTAGTEQFASMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVI
TRVKGSQPAPILLVANKFDLDCQREVSTAEGNALAQLWDCPFIEASAKDR
INVNEVFATIVREMNLTQENRQKKNYCCCTLL*

RE63021.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
Rap2l-PA 182 CG3204-PA 1..182 1..182 945 100 Plus
Rap2l-PD 116 CG3204-PD 1..116 67..182 609 100 Plus
Rap2l-PC 116 CG3204-PC 1..116 67..182 609 100 Plus
R-PC 184 CG1956-PC 1..184 1..182 523 56 Plus
R-PB 184 CG1956-PB 1..184 1..182 523 56 Plus