Clone RE63063 Report

Search the DGRC for RE63063

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:630
Well:63
Vector:pFlc-1
Associated Gene/TranscriptCG13041-RA
Protein status:RE63063.pep: gold
Preliminary Size:389
Sequenced Size:533

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13041 2002-01-01 Sim4 clustering to Release 2
CG13041 2003-01-01 Sim4 clustering to Release 3
CG13041 2008-04-29 Release 5.5 accounting
CG13041 2008-08-15 Release 5.9 accounting
CG13041 2008-12-18 5.12 accounting

Clone Sequence Records

RE63063.complete Sequence

533 bp (533 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071564

> RE63063.complete
GTCAGTCATCTCTCTGAGTTTATCCCAAAAACAACCAACCAACCAACCAA
ACCTAATTCAAGATGTTCAAATTTGTTGCTGTCATCGCTCTCCTGGTCGC
CACCGCCAGTGCTGGTCTCATCGAGACTCACCATGTGGTGCACGAGCCCG
TTCTGGCCAAGGTTGGATCGGTGGTGCACTCTGCTCCCTCGGCGGTTTCC
CACCAGAGCATCACCCAGGTGCACAGCAAGGCGGTGGTGCAGCCAGTGGT
TGCTCCCATCGTGAAGACCACCACCTACTCCCATCCCGCCGTTGCCGTCC
ACGCTGCTCCAGTGGTTCACTCCGTGCCCGTTGTCCACGCCGCTCCAGTC
GTCCACTCTGTGCCTCTGGTCCACTCAGCTCCCCTCGTCAAGTCGGTGGT
GCACTCCGCTCCCCTGGCCTACACCCTGCACCACTAAGGACGCAAATGTG
ATACAGTATTTACGATTTTTTGTTTCAATAAATGTTTTTCGTTTTGTCAT
AACAAGTTAAAAAAAAGAAAAAAAAAAAAAAAA

RE63063.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13041-RA 757 CG13041-RA 213..721 2..510 2545 100 Plus
CG13060-RA 723 CG13060-RA 212..512 58..358 1385 97.3 Plus
CG13060-RA 723 CG13060-RA 547..612 372..437 285 95.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16308702..16309137 510..75 2150 99.5 Minus
chr3L 24539361 chr3L 16309754..16310131 81..437 1340 91.5 Plus
chr3L 24539361 chr3L 16309196..16309270 76..2 375 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:08:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16318952..16319387 510..75 2180 100 Minus
3L 28110227 3L 16320004..16320381 81..437 1355 91.8 Plus
3L 28110227 3L 16319446..16319520 76..2 375 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16312052..16312487 510..75 2180 100 Minus
3L 28103327 3L 16313104..16313381 81..358 1345 98.9 Plus
3L 28103327 3L 16312546..16312620 76..2 375 100 Minus
3L 28103327 3L 16313416..16313481 372..437 285 95.4 Plus
Blast to na_te.dros performed 2019-03-16 23:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
Juan 4236 Juan JUAN 4236bp 3972..4024 451..502 118 71.7 Plus

RE63063.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:30:05 Download gff for RE63063.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16308702..16309137 75..510 99 <- Minus
chr3L 16309198..16309270 1..74 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:29:33 Download gff for RE63063.complete
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 1..375 63..437 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:11:53 Download gff for RE63063.complete
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 1..375 63..437 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:21:03 Download gff for RE63063.complete
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 1..375 63..437 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:36:08 Download gff for RE63063.complete
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 1..375 63..437 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:51:05 Download gff for RE63063.complete
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 1..375 63..437 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:42:22 Download gff for RE63063.complete
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 1..509 2..510 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:11:53 Download gff for RE63063.complete
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 2..508 2..508 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:21:03 Download gff for RE63063.complete
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 6..513 1..508 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:36:08 Download gff for RE63063.complete
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 1..509 2..510 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:51:05 Download gff for RE63063.complete
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 6..513 1..508 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:30:05 Download gff for RE63063.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16319448..16319520 1..74 98   Minus
3L 16318952..16319387 75..510 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:30:05 Download gff for RE63063.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16319448..16319520 1..74 98   Minus
3L 16318952..16319387 75..510 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:30:05 Download gff for RE63063.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16319448..16319520 1..74 98   Minus
3L 16318952..16319387 75..510 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:21:03 Download gff for RE63063.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16312548..16312620 1..74 98   Minus
arm_3L 16312052..16312487 75..510 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:13:29 Download gff for RE63063.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16312052..16312487 75..510 100 <- Minus
3L 16312548..16312620 1..74 98   Minus

RE63063.hyp Sequence

Translation from 0 to 450

> RE63063.hyp
SVISLSLSQKQPTNQPNLIQDVQICCCHRSPGRHRQCWSHRDSPCGARAR
SGQGWIGGALCSLGGFPPEHHPGAQQGGGAASGCSHREDHHLLPSRRCRP
RCSSGSLRARCPRRSSRPLCASGPLSSPRQVGGALRSPGLHPAPLRTQM*
Sequence RE63063.hyp has no blast hits.

RE63063.pep Sequence

Translation from 62 to 436

> RE63063.pep
MFKFVAVIALLVATASAGLIETHHVVHEPVLAKVGSVVHSAPSAVSHQSI
TQVHSKAVVQPVVAPIVKTTTYSHPAVAVHAAPVVHSVPVVHAAPVVHSV
PLVHSAPLVKSVVHSAPLAYTLHH*

RE63063.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24181-PA 136 GF24181-PA 1..136 1..124 418 80.1 Plus
Dana\GF10296-PA 136 GF10296-PA 1..136 1..124 324 80.9 Plus
Dana\GF10297-PA 112 GF10297-PA 1..96 1..87 178 44.9 Plus
Dana\GF24178-PA 138 GF24178-PA 1..128 1..122 164 47.8 Plus
Dana\GF10299-PA 158 GF10299-PA 1..148 1..124 159 42.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15985-PA 136 GG15985-PA 1..136 1..124 455 86 Plus
Dere\GG13467-PA 136 GG13467-PA 1..136 1..124 428 86 Plus
Dere\GG13469-PA 117 GG13469-PA 1..96 1..87 185 46.9 Plus
Dere\GG13471-PA 155 GG13471-PA 33..131 22..121 180 55.7 Plus
Dere\GG15987-PA 157 GG15987-PA 1..115 1..122 169 50.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15877-PA 123 GH15877-PA 1..123 1..124 339 68.5 Plus
Dgri\GH15606-PA 114 GH15606-PA 1..114 1..124 327 73.4 Plus
Dgri\GH15608-PA 163 GH15608-PA 33..158 22..121 173 52.4 Plus
Dgri\GH15607-PA 111 GH15607-PA 35..96 25..87 162 56.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG13041-PA 124 CG13041-PA 1..124 1..124 621 100 Plus
CG13060-PA 131 CG13060-PA 1..131 1..124 584 90.8 Plus
CG13044-PA 155 CG13044-PA 1..131 1..121 264 50 Plus
CG13040-PB 185 CG13040-PB 1..144 1..124 236 45.5 Plus
CG13040-PA 185 CG13040-PA 1..144 1..124 236 45.5 Plus
CG13042-PA 117 CG13042-PA 1..96 1..87 206 46.9 Plus
CG13043-PA 148 CG13043-PA 1..143 1..121 203 47.3 Plus
CG13059-PA 155 CG13059-PA 1..144 1..123 203 45.2 Plus
CG13063-PA 129 CG13063-PA 1..115 1..99 174 47.5 Plus
CG4962-PA 123 CG4962-PA 1..102 1..106 153 34.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16526-PA 111 GI16526-PA 1..111 1..124 314 65.3 Plus
Dmoj\GI12653-PA 111 GI12653-PA 1..111 1..124 314 65.3 Plus
Dmoj\GI12659-PA 111 GI12659-PA 1..111 1..124 312 64.5 Plus
Dmoj\GI16882-PA 111 GI16882-PA 1..111 1..124 312 64.5 Plus
Dmoj\GI12654-PA 131 GI12654-PA 1..130 1..124 160 40.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18008-PA 125 GL18008-PA 1..125 1..124 358 65.7 Plus
Dper\GL17851-PA 135 GL17851-PA 1..135 1..124 336 71 Plus
Dper\GL18009-PA 110 GL18009-PA 1..94 1..87 167 46.9 Plus
Dper\GL18011-PA 152 GL18011-PA 35..123 25..121 161 53 Plus
Dper\GL18007-PA 185 GL18007-PA 1..117 1..105 148 48.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28363-PA 125 GA28363-PA 1..125 1..124 355 65 Plus
Dpse\GA28513-PA 135 GA28513-PA 1..135 1..124 344 71.7 Plus
Dpse\GA11996-PA 110 GA11996-PA 1..94 1..87 167 46.9 Plus
Dpse\GA11998-PA 152 GA11998-PA 35..123 25..121 161 53 Plus
Dpse\GA11994-PA 191 GA11994-PA 1..117 1..105 148 48.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25617-PA 136 GM25617-PA 1..136 1..124 424 86 Plus
Dsec\GM24416-PA 136 GM24416-PA 1..136 1..124 424 86.8 Plus
Dsec\GM24418-PA 117 GM24418-PA 1..96 1..87 187 46.9 Plus
Dsec\GM24420-PA 155 GM24420-PA 33..131 22..121 180 55.7 Plus
Dsec\GM24415-PA 185 GM24415-PA 1..131 1..114 172 46.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14622-PA 133 GD14622-PA 1..133 1..124 440 91 Plus
Dsim\GD12487-PA 136 GD12487-PA 1..136 1..124 427 87.5 Plus
Dsim\GD12488-PA 117 GD12488-PA 1..96 1..87 187 46.9 Plus
Dsim\GD12490-PA 155 GD12490-PA 33..125 22..121 183 58.4 Plus
Dsim\GD12485-PA 185 GD12485-PA 1..121 1..104 173 48.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12631-PA 123 GJ12631-PA 1..123 1..124 381 74.6 Plus
Dvir\GJ12779-PA 115 GJ12779-PA 1..115 1..124 368 75.8 Plus
Dvir\GJ12632-PA 113 GJ12632-PA 36..97 25..87 158 54.7 Plus
Dvir\GJ12633-PA 170 GJ12633-PA 36..165 25..121 144 43.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16560-PA 128 GK16560-PA 1..128 1..124 307 70.4 Plus
Dwil\GK17640-PA 128 GK17640-PA 1..128 1..124 261 69.6 Plus
Dwil\GK17643-PA 148 GK17643-PA 38..128 26..120 184 52.1 Plus
Dwil\GK17641-PA 115 GK17641-PA 1..98 1..87 178 45.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19548-PA 136 GE19548-PA 1..136 1..124 424 86 Plus
Dyak\GE23111-PA 136 GE23111-PA 1..136 1..124 419 85.3 Plus
Dyak\GE22898-PA 140 GE22898-PA 9..140 5..124 397 86.4 Plus
Dyak\GE22804-PA 155 GE22804-PA 29..131 18..121 187 55.5 Plus
Dyak\GE22801-PA 117 GE22801-PA 1..96 1..87 185 46.9 Plus