Clone RE63168 Report

Search the DGRC for RE63168

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:631
Well:68
Vector:pFlc-1
Associated Gene/TranscriptCG7603-RA
Protein status:RE63168.pep: gold
Preliminary Size:486
Sequenced Size:773

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7603 2001-12-14 Blastp of sequenced clone
CG7603 2002-01-01 Sim4 clustering to Release 2
CG7603 2003-01-01 Sim4 clustering to Release 3
CG7603 2008-04-29 Release 5.5 accounting
CG7603 2008-08-15 Release 5.9 accounting
CG7603 2008-12-18 5.12 accounting

Clone Sequence Records

RE63168.complete Sequence

773 bp (773 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071567

> RE63168.complete
AAAAGCGGCAGATTTTAACTGCTACGTAGACACGGTCACTCCGACAATAA
TATGAAGTAGAAAAACAAGGAATTTTCCAAAAATTCTGAACGAAAACGAC
CAGACTGCTATTGTTTGGATACACCCAAAGACCGCAATAGACTGTCACTC
TCTCTTCCCCAAAACAAACGAATAAACATGGTTCTAGGATTTCTAGTGCG
CGGCGGTCTGGTGGCCGCAACCGTCTACTACACACAAAAGGTGGGCATCT
GGGGAGACTCTGACCAGACGGACAAGCTGTACAACGACATCAAGTCGGAG
CTGCGCCCGCATGTCCAGAAGCTGGAGAAGCAGCTGCCCTTCGAAGTGCC
GCAGTTGCCCAAAACCGGCGAGATGCGCTTCCTGGCCAAGCACTACTACA
ACGAGGGCGTGAAGAACACCTTCCGTTTCATCCACATGCTGCCCTGCTAC
GCAGGCAGGGGCCTCAAGAAGGTCAAGGACACGTTCCAGGACTTTGCCCA
ATCCCCAGCCATCGCCGGCGGTGCGGAGTCCAGTCCGCCGAAGTAACCTG
ACCCACTGCTCTTCAATGGCAGGCTGTTTTCGTGTTAGCTCATAGTTAGC
CTATTGAATAATGTCGTTGTAATGTGTCGTTATTCCTCGATCCGCTCGCC
AGCGGATAAGCGACTATAGATCTGTTCTCGACGTACTGAAACGCATCGAA
CTGGAACGTCCAGTTTAGAAATAAACAATTCTACGTGGTAGGCGTTAAGA
TCGCACTTAAAAAAAAAAAAAAA

RE63168.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG7603.a 2352 CG7603.a 41..800 2..761 3800 100 Plus
CG7603-RA 963 CG7603-RA 41..800 2..761 3800 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17455696..17456266 188..758 2855 100 Plus
chr3L 24539361 chr3L 17455448..17455634 2..188 935 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:08:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17466198..17466771 188..761 2870 100 Plus
3L 28110227 3L 17465950..17466136 2..188 935 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17459298..17459871 188..761 2870 100 Plus
3L 28103327 3L 17459050..17459236 2..188 935 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:50:49 has no hits.

RE63168.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:51:56 Download gff for RE63168.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17455447..17455634 1..188 99 -> Plus
chr3L 17455697..17456266 189..758 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:29:39 Download gff for RE63168.complete
Subject Subject Range Query Range Percent Splice Strand
CG7603-RA 1..369 178..546 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:10:32 Download gff for RE63168.complete
Subject Subject Range Query Range Percent Splice Strand
CG7603-RA 1..369 178..546 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:33:38 Download gff for RE63168.complete
Subject Subject Range Query Range Percent Splice Strand
CG7603-RA 1..369 178..546 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:34:42 Download gff for RE63168.complete
Subject Subject Range Query Range Percent Splice Strand
CG7603-RA 1..369 178..546 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:35:59 Download gff for RE63168.complete
Subject Subject Range Query Range Percent Splice Strand
CG7603-RA 1..369 178..546 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:40:26 Download gff for RE63168.complete
Subject Subject Range Query Range Percent Splice Strand
CG7603-RA 2..758 2..758 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:10:32 Download gff for RE63168.complete
Subject Subject Range Query Range Percent Splice Strand
CG7603-RA 5..762 1..758 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:33:38 Download gff for RE63168.complete
Subject Subject Range Query Range Percent Splice Strand
CG7603-RA 5..762 1..758 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:34:42 Download gff for RE63168.complete
Subject Subject Range Query Range Percent Splice Strand
CG7603-RA 2..758 2..758 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:35:59 Download gff for RE63168.complete
Subject Subject Range Query Range Percent Splice Strand
CG7603-RA 5..762 1..758 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:51:56 Download gff for RE63168.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17465949..17466136 1..188 99 -> Plus
3L 17466199..17466768 189..758 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:51:56 Download gff for RE63168.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17465949..17466136 1..188 99 -> Plus
3L 17466199..17466768 189..758 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:51:56 Download gff for RE63168.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17465949..17466136 1..188 99 -> Plus
3L 17466199..17466768 189..758 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:33:38 Download gff for RE63168.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17459049..17459236 1..188 99 -> Plus
arm_3L 17459299..17459868 189..758 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:11:57 Download gff for RE63168.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17459299..17459868 189..758 100   Plus
3L 17459049..17459236 1..188 99 -> Plus

RE63168.hyp Sequence

Translation from 177 to 545

> RE63168.hyp
MVLGFLVRGGLVAATVYYTQKVGIWGDSDQTDKLYNDIKSELRPHVQKLE
KQLPFEVPQLPKTGEMRFLAKHYYNEGVKNTFRFIHMLPCYAGRGLKKVK
DTFQDFAQSPAIAGGAESSPPK*

RE63168.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:29:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG7603-PA 122 CG7603-PA 1..122 1..122 647 100 Plus
CG15296-PB 169 CG15296-PB 1..104 1..108 159 36.1 Plus
CG15296-PA 169 CG15296-PA 1..104 1..108 159 36.1 Plus
CG43328-PB 241 CG43328-PB 1..109 1..109 156 28.4 Plus
CG43328-PA 241 CG43328-PA 1..109 1..109 156 28.4 Plus

RE63168.pep Sequence

Translation from 177 to 545

> RE63168.pep
MVLGFLVRGGLVAATVYYTQKVGIWGDSDQTDKLYNDIKSELRPHVQKLE
KQLPFEVPQLPKTGEMRFLAKHYYNEGVKNTFRFIHMLPCYAGRGLKKVK
DTFQDFAQSPAIAGGAESSPPK*

RE63168.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24204-PA 121 GF24204-PA 1..115 1..115 520 79.1 Plus
Dana\GF13430-PA 367 GF13430-PA 146..234 1..89 178 34.8 Plus
Dana\GF19552-PA 170 GF19552-PA 1..109 1..112 148 30.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13616-PA 122 GG13616-PA 1..122 1..122 635 96.7 Plus
Dere\GG18914-PA 169 GG18914-PA 1..88 1..92 183 42.4 Plus
Dere\GG22223-PA 396 GG22223-PA 156..264 1..109 178 31.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15187-PA 124 GH15187-PA 1..114 1..114 486 73.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:12
Subject Length Description Subject Range Query Range Score Percent Strand
QIL1-PA 122 CG7603-PA 1..122 1..122 647 100 Plus
CG15296-PB 169 CG15296-PB 1..104 1..108 159 36.1 Plus
CG15296-PA 169 CG15296-PA 1..104 1..108 159 36.1 Plus
CG43328-PB 241 CG43328-PB 1..109 1..109 156 28.4 Plus
CG43328-PA 241 CG43328-PA 1..109 1..109 156 28.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12127-PA 125 GI12127-PA 1..115 1..115 518 77.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15582-PA 124 GL15582-PA 1..121 1..121 510 74.4 Plus
Dper\GL11608-PA 242 GL11608-PA 1..101 1..106 136 30.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20474-PA 124 GA20474-PA 1..121 1..121 515 75.2 Plus
Dpse\GA24789-PA 258 GA24789-PA 1..99 1..99 146 34.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25700-PA 122 GM25700-PA 1..122 1..122 649 99.2 Plus
Dsec\GM11305-PA 169 GM11305-PA 1..88 1..92 169 40.2 Plus
Dsec\GM20011-PA 396 GM20011-PA 156..264 1..109 160 28.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14707-PA 122 GD14707-PA 1..122 1..122 645 98.4 Plus
Dsim\GD16028-PA 169 GD16028-PA 1..88 1..92 168 40.2 Plus
Dsim\GD25500-PA 396 GD25500-PA 156..264 1..109 157 28.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13399-PA 126 GJ13399-PA 1..117 1..117 469 66.7 Plus
Dvir\GJ17148-PA 114 GJ17148-PA 1..105 1..104 132 30.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17742-PA 128 GK17742-PA 1..117 1..119 512 76.5 Plus
Dwil\GK21391-PA 112 GK21391-PA 1..107 1..104 138 31.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19912-PA 122 GE19912-PA 1..122 1..122 625 95.1 Plus
Dyak\GE14221-PA 389 GE14221-PA 156..264 1..109 174 31.2 Plus