Clone RE63284 Report

Search the DGRC for RE63284

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:632
Well:84
Vector:pFlc-1
Associated Gene/TranscriptCG18081-RA
Protein status:RE63284.pep: gold
Preliminary Size:234
Sequenced Size:735

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18081 2001-12-14 Blastp of sequenced clone
CG18081 2002-01-01 Sim4 clustering to Release 2
CG18081 2003-01-01 Sim4 clustering to Release 3
CG18081 2008-04-29 Release 5.5 accounting
CG18081 2008-08-15 Release 5.9 accounting
CG18081 2008-12-18 5.12 accounting

Clone Sequence Records

RE63284.complete Sequence

735 bp (735 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071570

> RE63284.complete
ATCGTTCAGCTCTGGTCCCATTTAATCCTGGCAGCGAAACAAAACCCGAC
AAATTGATACAAATTTACGGTTAATCGTTAATAATTTCGGGTAAAAAATC
AAAACAGTTTGTAACAACGAATTTTACGTAACTGCAAAGGCTGCATCACA
CCTGCATTTAGTACAGCCAACCAAATTTAATCGGGTTAATTAGCAAGAAA
TGGCACGTGGACACCAGAAGATCCAGTCGCAGGCGAAGGCCTCCGAGAAG
CAGGCCAAACTAAAGAAGCAACAAGGACACAGTGCCAACGACCAGAAGAA
GGCGGCCCAGAAGGCACTTGTCTATGTGTGCGCCGTTTGCAAGTCGCAAA
TGCCCGATCCGAAGACTTACAAGCAGCATTTCGAGAACAAGCATCCCAAG
AATGACATGCCCGATGAGCTGAAGGAGGTCTGATGACCGATGTGGCTGCG
TGCATATATAAATATATCAAGCTGATCGAAATCGACGAATTTCCTACCAG
TACGAAACTTTTGAAACAATAACTTTACAACAGCCCCGACAAAACAAACA
TCAACATTTAAGTCGATGAGAGGAGGGCGCGTAAAGTTAGAACATAGTTT
CCAAAGCTAAGGGCCCAGCTGAATTTTTTATATACACACTGCTGACTTTT
GGTTTATACTTTGAAAATAACACATATGGCTACCACAACAATACAAAGAA
AATTTACACATAGTAAAATAAAAAAAAAAAAAAAA

RE63284.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-RA 1030 CG18081-RA 34..752 4..722 3595 100 Plus
CG15715-RA 1112 CG15715-RA 362..649 149..436 1230 95.1 Plus
CG15715-RA 1112 CG15715-RA 662..729 469..536 190 85.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:43:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15823903..15824280 719..342 1890 100 Minus
chr3L 24539361 chr3L 15825021..15825210 193..4 920 98.9 Minus
chr3L 24539361 chr3L 15824561..15824712 343..192 745 99.3 Minus
chr3L 24539361 chr3L 15826610..15826761 343..192 715 98 Minus
chr3L 24539361 chr3L 15825986..15826080 436..342 370 92.6 Minus
chr3L 24539361 chr3L 15825906..15825973 536..469 190 85.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:09:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:43:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15834073..15834453 722..342 1905 100 Minus
3L 28110227 3L 15835194..15835383 193..4 950 100 Minus
3L 28110227 3L 15834734..15834885 343..192 760 100 Minus
3L 28110227 3L 15836780..15836931 343..192 730 98.7 Minus
3L 28110227 3L 15836156..15836250 436..342 355 91.6 Minus
3L 28110227 3L 15836076..15836143 536..469 190 85.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15827173..15827553 722..342 1905 100 Minus
3L 28103327 3L 15828294..15828483 193..4 950 100 Minus
3L 28103327 3L 15827834..15827985 343..192 760 100 Minus
3L 28103327 3L 15829880..15830031 343..192 730 98.6 Minus
3L 28103327 3L 15829256..15829350 436..342 355 91.5 Minus
3L 28103327 3L 15829176..15829243 536..469 190 85.2 Minus
3L 28103327 3L 15830357..15830401 193..149 165 91.1 Minus
Blast to na_te.dros performed on 2019-03-16 12:43:50 has no hits.

RE63284.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:44:40 Download gff for RE63284.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15823903..15824278 344..719 100 <- Minus
chr3L 15824561..15824710 194..343 99 <- Minus
chr3L 15825021..15825213 1..193 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:29:41 Download gff for RE63284.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 1..234 200..433 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:09:03 Download gff for RE63284.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 1..234 200..433 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:50:35 Download gff for RE63284.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 1..234 200..433 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:33:18 Download gff for RE63284.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 1..234 200..433 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:53:13 Download gff for RE63284.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 1..234 200..433 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:38:16 Download gff for RE63284.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 1..719 1..719 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:09:03 Download gff for RE63284.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 1..719 1..719 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:50:35 Download gff for RE63284.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 3..721 1..719 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:33:18 Download gff for RE63284.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 1..719 1..719 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:53:13 Download gff for RE63284.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 3..721 1..719 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:44:40 Download gff for RE63284.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15834076..15834451 344..719 100 <- Minus
3L 15834734..15834883 194..343 100 <- Minus
3L 15835194..15835386 1..193 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:44:40 Download gff for RE63284.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15834076..15834451 344..719 100 <- Minus
3L 15834734..15834883 194..343 100 <- Minus
3L 15835194..15835386 1..193 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:44:40 Download gff for RE63284.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15834076..15834451 344..719 100 <- Minus
3L 15834734..15834883 194..343 100 <- Minus
3L 15835194..15835386 1..193 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:50:35 Download gff for RE63284.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15827176..15827551 344..719 100 <- Minus
arm_3L 15827834..15827983 194..343 100 <- Minus
arm_3L 15828294..15828486 1..193 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:10:20 Download gff for RE63284.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15827176..15827551 344..719 100 <- Minus
3L 15827834..15827983 194..343 100 <- Minus
3L 15828294..15828486 1..193 99   Minus

RE63284.hyp Sequence

Translation from 199 to 432

> RE63284.hyp
MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQ
MPDPKTYKQHFENKHPKNDMPDELKEV*

RE63284.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:57:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-PC 77 CG18081-PC 1..77 1..77 406 100 Plus
CG18081-PB 77 CG18081-PB 1..77 1..77 406 100 Plus
CG18081-PA 77 CG18081-PA 1..77 1..77 406 100 Plus
CG15715-PB 77 CG15715-PB 1..77 1..77 398 97.4 Plus
CG15715-PA 77 CG15715-PA 1..77 1..77 398 97.4 Plus

RE63284.pep Sequence

Translation from 199 to 432

> RE63284.pep
MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQ
MPDPKTYKQHFENKHPKNDMPDELKEV*

RE63284.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10372-PA 77 GF10372-PA 1..77 1..77 374 93.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13518-PA 77 GG13518-PA 1..77 1..77 383 97.4 Plus
Dere\GG13517-PA 77 GG13517-PA 1..77 1..77 383 97.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14364-PA 77 GH14364-PA 1..77 1..77 359 88.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-PC 77 CG18081-PC 1..77 1..77 406 100 Plus
CG18081-PB 77 CG18081-PB 1..77 1..77 406 100 Plus
CG18081-PA 77 CG18081-PA 1..77 1..77 406 100 Plus
CG15715-PB 77 CG15715-PB 1..77 1..77 398 97.4 Plus
CG15715-PA 77 CG15715-PA 1..77 1..77 398 97.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20814-PA 77 GI20814-PA 1..77 1..77 369 90.9 Plus
Dmoj\GI11305-PA 77 GI11305-PA 1..77 1..77 363 89.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24927-PA 77 GL24927-PA 1..77 1..77 364 90.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14782-PA 77 GA14782-PA 1..77 1..77 364 90.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24462-PA 77 GM24462-PA 1..77 1..77 389 98.7 Plus
Dsec\GM24461-PA 579 GM24461-PA 522..579 19..77 265 89.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12534-PA 77 GD12534-PA 1..77 1..77 389 98.7 Plus
Dsim\GD12533-PA 77 GD12533-PA 1..77 1..77 389 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11224-PA 77 GJ11224-PA 1..77 1..77 363 89.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15865-PA 77 GK15865-PA 1..77 1..77 374 93.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22819-PA 77 GE22819-PA 1..77 1..77 389 98.7 Plus
Dyak\GE19809-PA 77 GE19809-PA 1..77 1..77 389 98.7 Plus
Dyak\GE22818-PA 77 GE22818-PA 1..77 1..77 385 97.4 Plus
Dyak\GE19808-PA 77 GE19808-PA 1..77 1..77 385 97.4 Plus