Clone RE63412 Report

Search the DGRC for RE63412

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:634
Well:12
Vector:pFlc-1
Associated Gene/TranscriptCG40045-RA
Protein status:RE63412.pep: gold
Sequenced Size:750

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG40045 2001-12-14 Blastp of sequenced clone
CG12798 2002-01-01 Sim4 clustering to Release 2
CG40045 2003-01-01 Sim4 clustering to Release 3
CG40045 2008-04-29 Release 5.5 accounting
CG40045 2008-08-15 Release 5.9 accounting
CG40045 2008-12-18 5.12 accounting

Clone Sequence Records

RE63412.complete Sequence

750 bp (750 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071574

> RE63412.complete
AGTTCTTTTTTATGTTTGGCCTTTATAGAAAATTCGGTGGTCGATGTCGA
TCATTATATTTACTTTCAATACTAACTTATTTTTAAGCATACAATTTTTA
TTTGTGTTAATTACTTGTGCGTTAAACTGAACCAATTCATTTATCATACA
ACTTAGAATGTCTGAACTTCAGTCATCTTTACTGTTAAAAAAACAATTGG
CAGAACTAAACAAGAATCCAGTGGAAGGATTCTCCGCTGGTTTAATTGAT
GAGAATGATATATTTCGCTGGGAAGTTTTAATAATTGGACCGCCAGATAC
ACTGTACGAAGGAGGATTCTTTAAAGCTCATCTTTACTTTCCTAAAGAAT
ATCCGTTGCGTCCTCCTCGAATGAAGTTTGTTACAGAAATTTGGCACCCA
AATATTGAGAAGAATGGAGATGTCTGTATTTCTATTTTACATGAGCCTGG
AGACGATAAATGGGGCTACGAAAAAGCATCGGAGCGCTGGTTACCCGTGC
ATACAGTGGAGACTATCTTGATATCTGTAATATCAATGCTGGCCGATCCG
AACGATGAGTCTCCAGCAAACGTAGATGCTGCCAAGGAATGGCGAGAATC
CTATACCGACTTTAAACGCAAAGTTGCTCGCTGCGTCAGAAAAAGTCAGG
AGGAGTGCTCGTGAAGCGGCCCGCCCTATATTTGTATATTTATATTAAAC
ATTTTATACATTAAAAGGATTAACTTAAATATGTAAAAAAAAAAAAAAAA

RE63412.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG40045.c 886 CG40045.c 458..886 307..735 2145 100 Plus
CG40045.h 1371 CG40045.h 458..886 307..735 2145 100 Plus
CG40045.e 1420 CG40045.e 458..886 307..735 2145 100 Plus
CG40045.c 886 CG40045.c 11..317 1..307 1535 100 Plus
CG40045.h 1371 CG40045.h 11..317 1..307 1535 100 Plus
CG40045.e 1420 CG40045.e 11..317 1..307 1535 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 24024339..24024766 307..734 2140 100 Plus
chr3L 24539361 chr3L 24017428..24017630 1..203 1015 100 Plus
chr3L 24539361 chr3L 24019659..24019764 201..306 530 100 Plus
chr3R 27901430 chr3R 9542490..9542785 588..293 310 73.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:09:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 24035432..24035860 307..735 2145 100 Plus
3L 28110227 3L 24028521..24028723 1..203 1015 100 Plus
3L 28110227 3L 24030752..24030857 201..306 530 100 Plus
3R 32079331 3R 13717609..13717904 588..293 310 73.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 24028532..24028960 307..735 2145 100 Plus
3L 28103327 3L 24021621..24021823 1..203 1015 100 Plus
3L 28103327 3L 24023852..24023957 201..306 530 100 Plus
3R 31820162 3R 13458440..13458735 588..293 310 73.6 Minus
Blast to na_te.dros performed 2019-03-15 20:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 686..784 128..30 116 60 Minus
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 1346..1484 202..77 115 59.7 Minus
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 6229..6314 171..90 112 65.1 Minus
McClintock 6450 McClintock McCLINTOCK 6450bp 1004..1142 194..50 107 56.8 Minus

RE63412.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:27:20 Download gff for RE63412.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 24017428..24017630 1..203 100 -> Plus
chr3L 24019662..24019764 204..306 100 -> Plus
chr3L 24024339..24024766 307..734 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:29:47 Download gff for RE63412.complete
Subject Subject Range Query Range Percent Splice Strand
CG40045-RA 1..507 158..664 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:06:24 Download gff for RE63412.complete
Subject Subject Range Query Range Percent Splice Strand
CG40045-RA 1..507 158..664 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:13:07 Download gff for RE63412.complete
Subject Subject Range Query Range Percent Splice Strand
CG40045-RA 1..507 158..664 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:55 Download gff for RE63412.complete
Subject Subject Range Query Range Percent Splice Strand
CG40045-RA 1..507 158..664 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:21:47 Download gff for RE63412.complete
Subject Subject Range Query Range Percent Splice Strand
CG40045-RA 1..507 158..664 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:34:44 Download gff for RE63412.complete
Subject Subject Range Query Range Percent Splice Strand
CG40045-RA 1..734 1..734 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:06:23 Download gff for RE63412.complete
Subject Subject Range Query Range Percent Splice Strand
CG40045-RA 7..740 1..734 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:13:07 Download gff for RE63412.complete
Subject Subject Range Query Range Percent Splice Strand
CG40045-RA 7..740 1..734 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:55 Download gff for RE63412.complete
Subject Subject Range Query Range Percent Splice Strand
CG40045-RA 1..734 1..734 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:21:47 Download gff for RE63412.complete
Subject Subject Range Query Range Percent Splice Strand
CG40045-RA 7..740 1..734 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:27:20 Download gff for RE63412.complete
Subject Subject Range Query Range Percent Splice Strand
3L 24028521..24028723 1..203 100 -> Plus
3L 24030755..24030857 204..306 100 -> Plus
3L 24035432..24035859 307..734 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:27:20 Download gff for RE63412.complete
Subject Subject Range Query Range Percent Splice Strand
3L 24028521..24028723 1..203 100 -> Plus
3L 24030755..24030857 204..306 100 -> Plus
3L 24035432..24035859 307..734 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:27:20 Download gff for RE63412.complete
Subject Subject Range Query Range Percent Splice Strand
3L 24028521..24028723 1..203 100 -> Plus
3L 24030755..24030857 204..306 100 -> Plus
3L 24035432..24035859 307..734 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:13:07 Download gff for RE63412.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 24021621..24021823 1..203 100 -> Plus
arm_3L 24023855..24023957 204..306 100 -> Plus
arm_3L 24028532..24028959 307..734 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:07:20 Download gff for RE63412.complete
Subject Subject Range Query Range Percent Splice Strand
3L 24028532..24028959 307..734 100   Plus
3L 24021621..24021823 1..203 100 -> Plus
3L 24023855..24023957 204..306 100 -> Plus

RE63412.pep Sequence

Translation from 157 to 663

> RE63412.pep
MSELQSSLLLKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLY
EGGFFKAHLYFPKEYPLRPPRMKFVTEIWHPNIEKNGDVCISILHEPGDD
KWGYEKASERWLPVHTVETILISVISMLADPNDESPANVDAAKEWRESYT
DFKRKVARCVRKSQEECS*

RE63412.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:49:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18145-PA 167 GF18145-PA 1..166 1..166 789 86.7 Plus
Dana\GF19999-PA 113 GF19999-PA 1..113 56..168 601 99.1 Plus
Dana\GF21159-PA 167 GF21159-PA 6..162 10..163 456 56.1 Plus
Dana\GF21720-PA 311 GF21720-PA 4..148 6..146 410 53.8 Plus
Dana\GF16080-PA 151 GF16080-PA 9..148 10..163 286 36.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:49:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16305-PA 168 GG16305-PA 1..168 1..168 895 100 Plus
Dere\GG17023-PA 168 GG17023-PA 1..167 1..167 760 81.4 Plus
Dere\GG19056-PA 167 GG19056-PA 9..162 10..163 458 55.8 Plus
Dere\GG11277-PA 151 GG11277-PA 9..148 10..163 286 36.4 Plus
Dere\GG21088-PA 147 GG21088-PA 6..143 10..158 284 35.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22344-PA 170 GH22344-PA 16..170 14..168 829 98.7 Plus
Dgri\GH14044-PA 167 GH14044-PA 1..166 1..166 768 84.9 Plus
Dgri\GH24823-PA 167 GH24823-PA 9..162 10..163 466 55.8 Plus
Dgri\GH14479-PA 324 GH14479-PA 46..187 10..148 431 53.5 Plus
Dgri\GH15302-PA 151 GH15302-PA 9..148 10..163 286 36.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG40045-PA 168 CG40045-PA 1..168 1..168 903 100 Plus
CG40045-PD 167 CG40045-PD 1..167 1..168 884 99.4 Plus
Ubc87F-PA 168 CG9602-PA 1..166 1..166 772 83.1 Plus
CG40045-PC 132 CG40045-PC 15..132 51..168 649 100 Plus
CG40045-PB 97 CG40045-PB 1..97 72..168 527 100 Plus
Ubc7-PB 167 CG4443-PB 9..162 10..163 451 55.8 Plus
Ubc7-PA 167 CG4443-PA 9..162 10..163 451 55.8 Plus
CG7656-PF 317 CG7656-PF 45..199 10..157 434 52.3 Plus
CG7656-PA 317 CG7656-PA 45..199 10..157 434 52.3 Plus
CG7656-PE 319 CG7656-PE 45..186 10..148 433 54.2 Plus
CG7656-PD 319 CG7656-PD 45..186 10..148 433 54.2 Plus
eff-PC 147 CG7425-PC 6..143 10..158 286 35.5 Plus
eff-PB 147 CG7425-PB 6..143 10..158 286 35.5 Plus
eff-PA 147 CG7425-PA 6..143 10..158 286 35.5 Plus
Ubc6-PC 151 CG2013-PC 9..148 10..163 284 36.4 Plus
Ubc6-PA 151 CG2013-PA 9..148 10..163 284 36.4 Plus
ben-PE 151 CG18319-PE 1..146 1..162 255 31.5 Plus
ben-PD 151 CG18319-PD 1..146 1..162 255 31.5 Plus
ben-PB 151 CG18319-PB 1..146 1..162 255 31.5 Plus
ben-PC 151 CG18319-PC 1..146 1..162 255 31.5 Plus
ben-PA 151 CG18319-PA 1..146 1..162 255 31.5 Plus
CG10862-PA 354 CG10862-PA 213..331 10..142 249 35.3 Plus
CG3473-PB 151 CG3473-PB 10..130 12..146 244 34.8 Plus
CG3473-PA 151 CG3473-PA 10..130 12..146 244 34.8 Plus
CG5440-PC 169 CG5440-PC 26..157 10..155 243 34.2 Plus
CG5440-PB 169 CG5440-PB 26..157 10..155 243 34.2 Plus
vih-PA 178 CG10682-PA 37..160 10..147 237 36.2 Plus
Ubc10-PA 154 CG5788-PA 7..150 10..166 234 28.7 Plus
Ubc2-PD 232 CG6720-PD 87..221 6..154 230 32.2 Plus
Ubc2-PC 232 CG6720-PC 87..221 6..154 230 32.2 Plus
Ubc2-PB 232 CG6720-PB 87..221 6..154 230 32.2 Plus
Ubc2-PA 232 CG6720-PA 87..221 6..154 230 32.2 Plus
CG8188-PD 209 CG8188-PD 21..150 12..155 226 33.3 Plus
CG8188-PC 209 CG8188-PC 21..150 12..155 226 33.3 Plus
CG8188-PB 209 CG8188-PB 21..150 12..155 226 33.3 Plus
CG8188-PA 209 CG8188-PA 21..150 12..155 226 33.3 Plus
CG2574-PA 239 CG2574-PA 67..200 10..158 223 30.2 Plus
morgue-PA 491 CG15437-PA 349..453 17..134 211 38.1 Plus
lwr-PD 159 CG3018-PD 41..148 38..156 200 31.9 Plus
lwr-PC 159 CG3018-PC 41..148 38..156 200 31.9 Plus
lwr-PB 159 CG3018-PB 41..148 38..156 200 31.9 Plus
lwr-PA 159 CG3018-PA 41..148 38..156 200 31.9 Plus
Ubc4-PC 199 CG8284-PC 43..141 42..152 199 34.8 Plus
Ubc4-PB 199 CG8284-PB 43..141 42..152 199 34.8 Plus
Ubc4-PA 199 CG8284-PA 43..141 42..152 199 34.8 Plus
Ubc84D-PA 153 CG12799-PA 29..150 32..166 190 25.9 Plus
UbcE2M-PC 181 CG7375-PC 27..177 6..167 188 28.7 Plus
UbcE2M-PB 181 CG7375-PB 27..177 6..167 188 28.7 Plus
UbcE2M-PA 181 CG7375-PA 27..177 6..167 188 28.7 Plus
CG17030-PA 180 CG17030-PA 35..158 29..165 187 28.1 Plus
UbcE2H-PB 183 CG2257-PB 34..151 38..166 182 32.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23981-PA 168 GI23981-PA 1..168 1..168 887 99.4 Plus
Dmoj\GI24418-PA 167 GI24418-PA 1..166 1..166 792 88 Plus
Dmoj\GI16154-PA 167 GI16154-PA 9..162 10..163 467 56.5 Plus
Dmoj\GI13630-PA 321 GI13630-PA 44..185 10..148 436 54.2 Plus
Dmoj\GI22506-PA 151 GI22506-PA 9..148 10..163 286 36.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12289-PA 170 GL12289-PA 16..170 14..168 817 98.1 Plus
Dper\GL24447-PA 167 GL24447-PA 1..166 1..166 740 81.9 Plus
Dper\GL18350-PA 167 GL18350-PA 6..162 10..163 455 55.4 Plus
Dper\GL22516-PA 220 GL22516-PA 68..197 10..154 290 38.6 Plus
Dper\GL22213-PA 151 GL22213-PA 9..148 10..163 286 36.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26259-PA 170 GA26259-PA 16..170 14..168 818 98.1 Plus
Dpse\GA21906-PA 167 GA21906-PA 1..166 1..166 740 81.9 Plus
Dpse\GA18185-PA 167 GA18185-PA 6..162 10..163 455 55.4 Plus
Dpse\GA24534-PA 212 GA24534-PA 57..186 10..154 290 38.6 Plus
Dpse\GA15184-PA 151 GA15184-PA 9..148 10..163 286 36.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23423-PA 168 GM23423-PA 1..168 1..168 895 100 Plus
Dsec\GM25907-PA 168 GM25907-PA 1..167 1..167 757 81.4 Plus
Dsec\GM10669-PA 151 GM10669-PA 9..148 10..163 286 36.4 Plus
Dsec\GM25828-PA 147 GM25828-PA 6..143 10..158 284 35.5 Plus
Dsec\GM24479-PA 271 GM24479-PA 43..153 56..157 277 49.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11958-PA 168 GD11958-PA 1..168 1..168 895 100 Plus
Dsim\GD20475-PA 168 GD20475-PA 1..167 1..167 757 81.4 Plus
Dsim\GD24840-PA 167 GD24840-PA 9..162 10..163 439 54.5 Plus
Dsim\GD19645-PA 151 GD19645-PA 9..148 10..163 286 36.4 Plus
Dsim\GD20402-PA 147 GD20402-PA 6..143 10..158 284 35.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11187-PA 168 GJ11187-PA 1..168 1..168 895 100 Plus
Dvir\GJ14277-PA 220 GJ14277-PA 54..219 1..166 800 88 Plus
Dvir\GJ16432-PA 167 GJ16432-PA 6..162 10..163 468 56.7 Plus
Dvir\GJ13967-PA 318 GJ13967-PA 44..185 10..148 430 53.5 Plus
Dvir\GJ10109-PA 151 GJ10109-PA 9..148 10..163 286 36.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12909-PA 168 GK12909-PA 1..168 1..168 890 99.4 Plus
Dwil\GK13059-PA 167 GK13059-PA 1..166 1..166 767 83.1 Plus
Dwil\GK16076-PA 167 GK16076-PA 9..162 10..163 452 55.8 Plus
Dwil\GK20435-PA 322 GK20435-PA 47..188 10..148 434 54.2 Plus
Dwil\GK19931-PA 294 GK19931-PA 14..151 10..146 327 45.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15167-PA 168 GE15167-PA 1..168 1..168 895 100 Plus
Dyak\GE24416-PA 168 GE24416-PA 1..167 1..167 768 82.6 Plus
Dyak\crl-PA 167 GE17278-PA 9..162 10..163 458 55.8 Plus
Dyak\GE25319-PA 151 GE25319-PA 9..148 10..163 286 36.4 Plus
Dyak\eff-PA 147 GE26430-PA 6..143 10..158 284 35.5 Plus

RE63412.hyp Sequence

Translation from 157 to 663

> RE63412.hyp
MSELQSSLLLKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLY
EGGFFKAHLYFPKEYPLRPPRMKFVTEIWHPNIEKNGDVCISILHEPGDD
KWGYEKASERWLPVHTVETILISVISMLADPNDESPANVDAAKEWRESYT
DFKRKVARCVRKSQEECS*

RE63412.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG40045-PA 168 CG40045-PA 1..168 1..168 903 100 Plus
CG40045-PD 167 CG40045-PD 1..167 1..168 884 99.4 Plus
Ubc87F-PA 168 CG9602-PA 1..166 1..166 772 83.1 Plus
CG40045-PC 132 CG40045-PC 15..132 51..168 649 100 Plus
CG40045-PB 97 CG40045-PB 1..97 72..168 527 100 Plus