Clone RE63504 Report

Search the DGRC for RE63504

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:635
Well:4
Vector:pFlc-1
Associated Gene/TranscriptRpL41-RA
Protein status:RE63504.pep: gold
Sequenced Size:331

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30425 2001-12-17 Blastp of sequenced clone
CG2857 2002-01-01 Sim4 clustering to Release 2
RpL41 2008-04-29 Release 5.5 accounting
RpL41 2008-08-15 Release 5.9 accounting
RpL41 2008-12-18 5.12 accounting

Clone Sequence Records

RE63504.complete Sequence

331 bp (331 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071579

> RE63504.complete
CTTTTTTTCGTTCTCAAACCGTCGTCCAGACCAGAAGGAAAATGAGAGCT
AAGTGGCGTAAGAAGCGTATGCGTAGGTTGAAGCGTAAGCGCAGAAAGAT
GCGTGCAAGGTCCAAGTAAGCGCAGCAGCATTGCCCACTAAATGGAACTC
TTGATTGATGCTAACACCGAAACGAAAAACGCCGACTGGGTAGCCCTAAA
ATGGTGGCCCTAAAGTAATTTTGCAAACCAGTTTTCACACAAACGTACAT
GTGCATTTTAAATTCACGTAAAAATTGATTCTAATAAATTACTAGATTTT
CGCCAAGGTTCCACAACAAAAAAAAAAAAAA

RE63504.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
RpL41-RA 749 RpL41-RA 257..572 6..321 1565 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20789341..20789514 317..144 870 100 Minus
chr2R 21145070 chr2R 20789621..20789714 145..52 470 100 Minus
chr2R 21145070 chr2R 20789805..20789852 53..6 240 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:09:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24903413..24903590 321..144 875 99.4 Minus
2R 25286936 2R 24903697..24903790 145..52 470 100 Minus
2R 25286936 2R 24903881..24903928 53..6 240 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24904612..24904789 321..144 875 99.4 Minus
2R 25260384 2R 24904896..24904989 145..52 470 100 Minus
2R 25260384 2R 24905080..24905127 53..6 240 100 Minus
Blast to na_te.dros performed on 2019-03-16 21:18:46 has no hits.

RE63504.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:19:43 Download gff for RE63504.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20789341..20789513 145..317 100 <- Minus
chr2R 20789622..20789712 54..144 100 <- Minus
chr2R 20789805..20789857 1..53 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:29:55 Download gff for RE63504.complete
Subject Subject Range Query Range Percent Splice Strand
RpL41-RA 1..78 42..119 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:18 Download gff for RE63504.complete
Subject Subject Range Query Range Percent Splice Strand
RpL41-RA 1..78 42..119 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:37:15 Download gff for RE63504.complete
Subject Subject Range Query Range Percent Splice Strand
RpL41-RA 1..78 42..119 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:51 Download gff for RE63504.complete
Subject Subject Range Query Range Percent Splice Strand
RpL41-RA 1..78 42..119 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:15:21 Download gff for RE63504.complete
Subject Subject Range Query Range Percent Splice Strand
RpL41-RA 1..78 42..119 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:08:36 Download gff for RE63504.complete
Subject Subject Range Query Range Percent Splice Strand
RpL41-RA 2..313 6..317 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:18 Download gff for RE63504.complete
Subject Subject Range Query Range Percent Splice Strand
RpL41-RA 2..313 6..317 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:37:15 Download gff for RE63504.complete
Subject Subject Range Query Range Percent Splice Strand
RpL41-RA 3..319 1..317 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:52 Download gff for RE63504.complete
Subject Subject Range Query Range Percent Splice Strand
RpL41-RA 2..313 6..317 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:15:21 Download gff for RE63504.complete
Subject Subject Range Query Range Percent Splice Strand
RpL41-RA 3..319 1..317 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:43 Download gff for RE63504.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24903417..24903589 145..317 100 <- Minus
2R 24903698..24903788 54..144 100 <- Minus
2R 24903881..24903933 1..53 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:43 Download gff for RE63504.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24903417..24903589 145..317 100 <- Minus
2R 24903698..24903788 54..144 100 <- Minus
2R 24903881..24903933 1..53 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:43 Download gff for RE63504.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24903417..24903589 145..317 100 <- Minus
2R 24903698..24903788 54..144 100 <- Minus
2R 24903881..24903933 1..53 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:37:15 Download gff for RE63504.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20790940..20791112 145..317 100 <- Minus
arm_2R 20791221..20791311 54..144 100 <- Minus
arm_2R 20791404..20791456 1..53 96   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:45 Download gff for RE63504.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24904634..24904806 145..317 100 <- Minus
2R 24904915..24905005 54..144 100 <- Minus
2R 24905098..24905150 1..53 96   Minus

RE63504.hyp Sequence

Translation from 2 to 118

> RE63504.hyp
FFRSQTVVQTRRKMRAKWRKKRMRRLKRKRRKMRARSK*

RE63504.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
RpL41-PA 25 CG30425-PA 1..25 14..38 127 100 Plus

RE63504.pep Sequence

Translation from 41 to 118

> RE63504.pep
MRAKWRKKRMRRLKRKRRKMRARSK*

RE63504.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
RpL41-PA 25 CG30425-PA 1..25 1..25 127 100 Plus