RE63504.complete Sequence
331 bp (331 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071579
> RE63504.complete
CTTTTTTTCGTTCTCAAACCGTCGTCCAGACCAGAAGGAAAATGAGAGCT
AAGTGGCGTAAGAAGCGTATGCGTAGGTTGAAGCGTAAGCGCAGAAAGAT
GCGTGCAAGGTCCAAGTAAGCGCAGCAGCATTGCCCACTAAATGGAACTC
TTGATTGATGCTAACACCGAAACGAAAAACGCCGACTGGGTAGCCCTAAA
ATGGTGGCCCTAAAGTAATTTTGCAAACCAGTTTTCACACAAACGTACAT
GTGCATTTTAAATTCACGTAAAAATTGATTCTAATAAATTACTAGATTTT
CGCCAAGGTTCCACAACAAAAAAAAAAAAAA
RE63504.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:56:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL41-RA | 749 | RpL41-RA | 257..572 | 6..321 | 1565 | 99.6 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:18:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 20789341..20789514 | 317..144 | 870 | 100 | Minus |
chr2R | 21145070 | chr2R | 20789621..20789714 | 145..52 | 470 | 100 | Minus |
chr2R | 21145070 | chr2R | 20789805..20789852 | 53..6 | 240 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:09:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:18:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 24903413..24903590 | 321..144 | 875 | 99.4 | Minus |
2R | 25286936 | 2R | 24903697..24903790 | 145..52 | 470 | 100 | Minus |
2R | 25286936 | 2R | 24903881..24903928 | 53..6 | 240 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 24904612..24904789 | 321..144 | 875 | 99.4 | Minus |
2R | 25260384 | 2R | 24904896..24904989 | 145..52 | 470 | 100 | Minus |
2R | 25260384 | 2R | 24905080..24905127 | 53..6 | 240 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 21:18:46 has no hits.
RE63504.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:19:43 Download gff for
RE63504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 20789341..20789513 | 145..317 | 100 | <- | Minus |
chr2R | 20789622..20789712 | 54..144 | 100 | <- | Minus |
chr2R | 20789805..20789857 | 1..53 | 96 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:29:55 Download gff for
RE63504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL41-RA | 1..78 | 42..119 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:18 Download gff for
RE63504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL41-RA | 1..78 | 42..119 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:37:15 Download gff for
RE63504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL41-RA | 1..78 | 42..119 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:51 Download gff for
RE63504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL41-RA | 1..78 | 42..119 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:15:21 Download gff for
RE63504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL41-RA | 1..78 | 42..119 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:08:36 Download gff for
RE63504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL41-RA | 2..313 | 6..317 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:18 Download gff for
RE63504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL41-RA | 2..313 | 6..317 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:37:15 Download gff for
RE63504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL41-RA | 3..319 | 1..317 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:52 Download gff for
RE63504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL41-RA | 2..313 | 6..317 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:15:21 Download gff for
RE63504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL41-RA | 3..319 | 1..317 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:43 Download gff for
RE63504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24903417..24903589 | 145..317 | 100 | <- | Minus |
2R | 24903698..24903788 | 54..144 | 100 | <- | Minus |
2R | 24903881..24903933 | 1..53 | 96 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:43 Download gff for
RE63504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24903417..24903589 | 145..317 | 100 | <- | Minus |
2R | 24903698..24903788 | 54..144 | 100 | <- | Minus |
2R | 24903881..24903933 | 1..53 | 96 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:43 Download gff for
RE63504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24903417..24903589 | 145..317 | 100 | <- | Minus |
2R | 24903698..24903788 | 54..144 | 100 | <- | Minus |
2R | 24903881..24903933 | 1..53 | 96 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:37:15 Download gff for
RE63504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 20790940..20791112 | 145..317 | 100 | <- | Minus |
arm_2R | 20791221..20791311 | 54..144 | 100 | <- | Minus |
arm_2R | 20791404..20791456 | 1..53 | 96 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:45 Download gff for
RE63504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24904634..24904806 | 145..317 | 100 | <- | Minus |
2R | 24904915..24905005 | 54..144 | 100 | <- | Minus |
2R | 24905098..24905150 | 1..53 | 96 | | Minus |
RE63504.hyp Sequence
Translation from 2 to 118
> RE63504.hyp
FFRSQTVVQTRRKMRAKWRKKRMRRLKRKRRKMRARSK*
RE63504.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:57:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL41-PA | 25 | CG30425-PA | 1..25 | 14..38 | 127 | 100 | Plus |
RE63504.pep Sequence
Translation from 41 to 118
> RE63504.pep
MRAKWRKKRMRRLKRKRRKMRARSK*
RE63504.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL41-PA | 25 | CG30425-PA | 1..25 | 1..25 | 127 | 100 | Plus |