Clone RE63573 Report

Search the DGRC for RE63573

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:635
Well:73
Vector:pFlc-1
Associated Gene/TranscriptTwdlH-RA
Protein status:RE63573.pep: gold
Preliminary Size:1638
Sequenced Size:934

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31080 2001-12-13 Blastp of sequenced clone
CG14241 2002-01-01 Sim4 clustering to Release 2
CG31080 2003-01-01 Sim4 clustering to Release 3
TwdlH 2008-04-29 Release 5.5 accounting
TwdlH 2008-08-15 Release 5.9 accounting
TwdlH 2008-12-18 5.12 accounting

Clone Sequence Records

RE63573.complete Sequence

934 bp (934 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070579

> RE63573.complete
ATACTTGCCTTCGATCCAGCAATCCGAGCGGAGTTATCCACCTACACACC
AAAAATCAAGATGCGCGTCCTTATTGCTCTGTGCCTTGTGGCTGCCGTTA
GTGCCAGAAGTGGCTATAACTACCAGCCTGCAGCTTCTGCCCCAGCTGTC
GCATCCTTTGCTCCTTCCGGACCCAGTTACTCTCCTTCCGTGGCCGCTAG
CCAGGATGCCCCCGCCGAGACCTATGCACCTGCTTCTGCCCCCGAAGCTG
CTCCTTCCGCGGTTGCCACCAACTATGCGGCTCCCCAGGCCGAGCTCCAA
AAGGAGTTCTTCACGTACACCGCTGATGAGCAGGACTTCGTTGAACCAGC
TGGCTCTCAGCAGGTATCCGCCTCCTTGAACAAGGCCCTGCGTGTGATCT
TCATCAAGGGACCCGAGAACACTGGCCTGGAGAACGCTGCTGTGGCTCTG
GCCAAGCAGGCTGGACAGCAGGAGACCGCCATCTATGTCCTGAACAAGCA
GGCTGATATCGGAGATCTGAGCAACAAGCTGAACTCTATCCGCAACAACA
ACAACAACAAGCCCGAGGTGCACTTCGTGAAATACCGCACCAACCAGGAT
GCCCTCAACGCCCAGCAGGCCATCCAGTCGCAGTACGATCAGCTGGGAGG
ATCCTCCACCATTCTGAACGGAGGTGTGGCTCCCGTCCTGAACTTCGCAT
CTCAGCCAGCTGCCCAGCAAGTGGCCGCTCCCTCGGCTCCTGGTAGCTCC
TACCTGCCCGCTTCGGTCCTCCGTTTTCGCCAATAAGCAGTGACTGACCT
CAGACTGACCCATGACCCATCAACGATTCCTACGCACTCGCTGCGACCCA
CTTTGCTTAGTTTGTAAATCTCTCGAATTTCGATATGTGTCCCCAATAAA
ATATTGTTAATATAAAAGAAAAAAAAAAAAAAAA

RE63573.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlH-RA 977 TwdlH-RA 59..975 1..917 4585 100 Plus
TwdlH.a 1379 TwdlH.a 461..1377 1..917 4585 100 Plus
TwdlJ-RB 825 TwdlJ-RB 341..617 377..653 815 86.2 Plus
TwdlJ-RB 825 TwdlJ-RB 220..320 256..356 205 80.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22456986..22457828 76..917 4105 99.4 Plus
chr3R 27901430 chr3R 22453290..22453687 256..653 940 82.4 Plus
chr3R 27901430 chr3R 22451213..22451598 654..269 925 82.6 Minus
chr3R 27901430 chr3R 22442740..22443149 289..698 910 81.5 Plus
chr3R 27901430 chr3R 22447884..22448290 698..292 880 81.1 Minus
chr3R 27901430 chr3R 22445819..22446183 656..292 850 82.2 Minus
chr3R 27901430 chr3R 22455475..22455839 292..656 835 81.9 Plus
chr3R 27901430 chr3R 22449283..22449569 654..368 520 78.7 Minus
chr3R 27901430 chr3R 22456848..22456923 1..76 380 100 Plus
chr3R 27901430 chr3R 22480036..22480348 377..689 305 73.2 Plus
chr3R 27901430 chr3R 22443921..22444178 654..397 270 73.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:09:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26633872..26634713 76..917 4210 100 Plus
3R 32079331 3R 26630175..26630572 256..653 955 82.7 Plus
3R 32079331 3R 26628099..26628484 654..269 925 82.6 Minus
3R 32079331 3R 26619619..26620028 289..698 910 81.5 Plus
3R 32079331 3R 26624766..26625172 698..292 865 80.8 Minus
3R 32079331 3R 26622698..26623062 656..292 850 82.2 Minus
3R 32079331 3R 26632360..26632724 292..656 835 81.9 Plus
3R 32079331 3R 26626167..26626453 654..368 520 78.7 Minus
3R 32079331 3R 26633734..26633809 1..76 380 100 Plus
3R 32079331 3R 26656933..26657251 377..695 305 73 Plus
3R 32079331 3R 26620800..26621057 654..397 270 73.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26374703..26375544 76..917 4210 100 Plus
3R 31820162 3R 26360538..26360815 377..654 865 87.4 Plus
3R 31820162 3R 26368930..26369207 654..377 865 87.4 Minus
3R 31820162 3R 26363529..26363806 656..379 820 86.3 Minus
3R 31820162 3R 26371127..26371403 377..653 815 86.2 Plus
3R 31820162 3R 26365639..26365916 656..379 790 85.6 Minus
3R 31820162 3R 26373271..26373555 372..656 780 84.9 Plus
3R 31820162 3R 26367133..26367284 519..368 415 84.8 Minus
3R 31820162 3R 26374565..26374640 1..76 380 100 Plus
3R 31820162 3R 26397764..26397894 377..507 295 81.6 Plus
3R 31820162 3R 26366998..26367087 654..565 210 82.2 Minus
3R 31820162 3R 26371006..26371106 256..356 205 80.1 Plus
3R 31820162 3R 26361775..26361888 510..397 180 77.1 Minus
3R 31820162 3R 26373191..26373243 292..344 175 88.6 Plus
3R 31820162 3R 26365947..26366003 348..292 165 85.9 Minus
3R 31820162 3R 26381359..26381411 449..501 160 86.7 Plus
3R 31820162 3R 26363837..26363893 348..292 150 84.2 Minus
3R 31820162 3R 26360450..26360505 289..344 145 83.9 Plus
Blast to na_te.dros performed on 2019-03-16 21:18:49 has no hits.

RE63573.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:19:44 Download gff for RE63573.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22456848..22456922 1..75 100 -> Plus
chr3R 22456986..22457828 76..918 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:29:56 Download gff for RE63573.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlH-RA 1..726 61..786 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:17:17 Download gff for RE63573.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlH-RA 1..726 61..786 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:37:17 Download gff for RE63573.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlH-RA 1..726 61..786 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:43:23 Download gff for RE63573.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlH-RA 1..726 61..786 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:15:26 Download gff for RE63573.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlH-RA 1..726 61..786 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:49:52 Download gff for RE63573.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlH-RA 1..917 1..918 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:17:17 Download gff for RE63573.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlH-RA 1..917 1..918 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:37:17 Download gff for RE63573.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlH-RA 3..919 1..918 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:43:23 Download gff for RE63573.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlH-RA 1..917 1..918 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:15:26 Download gff for RE63573.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlH-RA 3..919 1..918 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:44 Download gff for RE63573.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26633734..26633808 1..75 100 -> Plus
3R 26633872..26634713 76..918 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:44 Download gff for RE63573.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26633734..26633808 1..75 100 -> Plus
3R 26633872..26634713 76..918 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:44 Download gff for RE63573.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26633734..26633808 1..75 100 -> Plus
3R 26633872..26634713 76..918 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:37:17 Download gff for RE63573.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22459456..22459530 1..75 100 -> Plus
arm_3R 22459594..22460435 76..918 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:19:31 Download gff for RE63573.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26374703..26375544 76..918 99   Plus
3R 26374565..26374639 1..75 100 -> Plus

RE63573.hyp Sequence

Translation from 0 to 785

> RE63573.hyp
ILAFDPAIRAELSTYTPKIKMRVLIALCLVAAVSARSGYNYQPAASAPAV
ASFAPSGPSYSPSVAASQDAPAETYAPASAPEAAPSAVATNYAAPQAELQ
KEFFTYTADEQDFVEPAGSQQVSASLNKALRVIFIKGPENTGLENAAVAL
AKQAGQQETAIYVLNKQADIGDLSNKLNSIRNNNNNKPEVHFVKYRTNQD
ALNAQQAIQSQYDQLGGSSTILNGGVAPVLNFASQPAAQQVAAPSAPGSS
YLPASVLRFRQ*

RE63573.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlH-PA 241 CG31080-PA 1..241 21..261 1200 100 Plus
TwdlK-PA 247 CG6460-PA 1..243 21..258 781 65.6 Plus
TwdlJ-PB 274 CG5471-PB 6..270 25..258 755 61.3 Plus
TwdlM-PA 288 CG5468-PA 1..286 21..258 655 53.3 Plus
TwdlL-PB 279 CG6447-PB 101..278 82..260 615 69.8 Plus

RE63573.pep Sequence

Translation from 60 to 785

> RE63573.pep
MRVLIALCLVAAVSARSGYNYQPAASAPAVASFAPSGPSYSPSVAASQDA
PAETYAPASAPEAAPSAVATNYAAPQAELQKEFFTYTADEQDFVEPAGSQ
QVSASLNKALRVIFIKGPENTGLENAAVALAKQAGQQETAIYVLNKQADI
GDLSNKLNSIRNNNNNKPEVHFVKYRTNQDALNAQQAIQSQYDQLGGSST
ILNGGVAPVLNFASQPAAQQVAAPSAPGSSYLPASVLRFRQ*

RE63573.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16446-PA 245 GF16446-PA 1..244 1..240 853 80.8 Plus
Dana\GF18573-PA 246 GF18573-PA 1..242 1..238 640 66.1 Plus
Dana\GF16444-PA 262 GF16444-PA 23..258 18..238 614 63.8 Plus
Dana\GF16443-PA 276 GF16443-PA 99..274 62..238 592 73.4 Plus
Dana\GF16445-PA 295 GF16445-PA 120..295 70..241 545 68.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11491-PA 241 GG11491-PA 1..241 1..241 868 89.6 Plus
Dere\GG12179-PA 239 GG12179-PA 1..235 1..238 732 65.7 Plus
Dere\GG11489-PA 274 GG11489-PA 1..270 1..238 693 59.6 Plus
Dere\GG11490-PA 285 GG11490-PA 116..279 74..238 566 74.5 Plus
Dere\GG11487-PA 286 GG11487-PA 109..284 62..238 553 72.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:34:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18876-PA 232 GH18876-PA 1..228 1..238 702 62.9 Plus
Dgri\GH18726-PA 286 GH18726-PA 7..282 4..238 685 55.8 Plus
Dgri\GH23186-PA 237 GH23186-PA 1..236 1..240 642 58.6 Plus
Dgri\GH18728-PA 237 GH18728-PA 1..236 1..240 641 59 Plus
Dgri\GH22538-PA 237 GH22538-PA 1..236 1..240 639 58.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlH-PA 241 CG31080-PA 1..241 1..241 1200 100 Plus
TwdlK-PA 247 CG6460-PA 1..243 1..238 781 65.6 Plus
TwdlJ-PB 274 CG5471-PB 6..270 5..238 755 61.3 Plus
TwdlM-PA 288 CG5468-PA 1..286 1..238 655 53.3 Plus
TwdlL-PB 279 CG6447-PB 101..278 62..240 615 69.8 Plus
TwdlL-PA 285 CG6447-PA 107..284 62..240 615 69.8 Plus
TwdlN-PA 309 CG5476-PA 127..303 59..238 612 70.6 Plus
TwdlB-PA 286 CG6478-PA 107..282 62..238 606 69.5 Plus
TwdlO-PA 229 CG6452-PA 1..224 1..238 552 52 Plus
TwdlP-PA 220 CG14240-PA 1..215 1..237 541 52.5 Plus
TwdlD-PA 256 CG14243-PA 1..240 1..237 536 51.4 Plus
Tb-PA 283 CG5480-PA 1..229 1..220 465 45.4 Plus
TwdlQ-PA 245 CG14250-PA 1..243 1..238 451 42.3 Plus
TwdlR-PA 325 CG31081-PA 14..236 4..235 285 33.6 Plus
TwdlV-PA 251 CG14640-PA 1..204 1..209 257 35.4 Plus
TwdlF-PA 354 CG14639-PA 5..277 4..214 248 28.2 Plus
TwdlG-PC 278 CG14643-PC 55..276 22..236 236 32.6 Plus
TwdlG-PB 278 CG14643-PB 55..276 22..236 236 32.6 Plus
TwdlG-PA 278 CG14643-PA 55..276 22..236 236 32.6 Plus
TwdlW-PA 308 CG4060-PA 131..258 81..209 236 43.8 Plus
Twdlalpha-PA 388 CG32574-PA 132..324 31..232 207 31.4 Plus
TwdlX-PA 346 CG32571-PA 145..275 77..209 204 39.1 Plus
TwdlY-PA 247 CG32570-PA 5..243 2..234 198 31.6 Plus
TwdlZ-PB 210 CG32569-PB 35..194 79..231 190 34.6 Plus
TwdlS-PA 228 CG14242-PA 37..166 69..199 182 37.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:34:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22881-PA 240 GI22881-PA 1..239 1..240 628 55.9 Plus
Dmoj\GI22877-PA 300 GI22877-PA 129..298 68..238 598 76 Plus
Dmoj\GI22878-PA 277 GI22878-PA 4..273 1..238 590 53.1 Plus
Dmoj\GI24735-PA 315 GI24735-PA 144..313 68..238 590 74.9 Plus
Dmoj\GI24736-PA 280 GI24736-PA 102..276 57..238 588 70.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:34:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23102-PA 264 GL23102-PA 1..263 1..240 884 72.2 Plus
Dper\GL24438-PA 285 GL24438-PA 6..281 3..238 693 58.7 Plus
Dper\GL23100-PA 293 GL23100-PA 1..289 1..238 692 57.9 Plus
Dper\GL23099-PA 284 GL23099-PA 113..282 68..238 582 74.3 Plus
Dper\GL24439-PA 231 GL24439-PA 1..226 1..238 566 55.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:34:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27141-PA 264 GA27141-PA 1..263 1..240 883 71.8 Plus
Dpse\GA26613-PA 250 GA26613-PA 1..246 1..238 712 64.4 Plus
Dpse\GA18905-PB 309 GA18905-PB 4..305 1..238 667 53.8 Plus
Dpse\GA18905-PA 309 GA18905-PA 4..305 1..238 667 53.8 Plus
Dpse\GA27140-PB 264 GA27140-PB 1..262 1..238 598 54.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:34:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10334-PA 241 GM10334-PA 1..241 1..241 1194 97.5 Plus
Dsec\GM10175-PA 247 GM10175-PA 1..246 1..240 688 65.2 Plus
Dsec\GM10331-PA 274 GM10331-PA 6..270 5..238 633 60 Plus
Dsec\GM10330-PA 265 GM10330-PA 1..263 1..238 594 57.2 Plus
Dsec\GM10177-PA 290 GM10177-PA 115..289 63..240 564 71.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:34:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21294-PA 241 GD21294-PA 1..241 1..241 1200 98.3 Plus
Dsim\GD18127-PA 247 GD18127-PA 1..246 1..240 661 63.8 Plus
Dsim\GD21292-PA 274 GD21292-PA 1..270 1..238 633 59.6 Plus
Dsim\GD21291-PA 275 GD21291-PA 98..273 62..238 586 72.9 Plus
Dsim\GD21293-PA 309 GD21293-PA 134..303 68..238 560 71.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14173-PA 284 GJ14173-PA 6..283 3..240 665 55.8 Plus
Dvir\GJ14563-PA 289 GJ14563-PA 118..287 68..238 639 75.4 Plus
Dvir\GJ14175-PA 232 GJ14175-PA 1..231 1..240 632 59.4 Plus
Dvir\GJ14564-PA 262 GJ14564-PA 1..258 1..238 604 57.1 Plus
Dvir\GJ14562-PA 230 GJ14562-PA 1..225 1..238 584 52.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13323-PA 246 GK13323-PA 1..245 1..240 708 68.8 Plus
Dwil\GK13959-PA 262 GK13959-PA 1..261 1..240 655 61.9 Plus
Dwil\GK13320-PA 284 GK13320-PA 119..282 74..238 588 76.4 Plus
Dwil\GK13964-PA 225 GK13964-PA 1..219 1..238 587 53.3 Plus
Dwil\GK13321-PA 289 GK13321-PA 7..285 4..238 587 55.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23681-PA 234 GE23681-PA 1..234 1..241 1014 90.9 Plus
Dyak\GE10623-PA 247 GE10623-PA 1..243 1..238 653 64.2 Plus
Dyak\GE23679-PA 274 GE23679-PA 8..270 7..238 621 59.7 Plus
Dyak\GE23678-PA 284 GE23678-PA 107..282 62..238 563 74.6 Plus
Dyak\GE23680-PA 302 GE23680-PA 127..296 68..238 562 72.5 Plus