Clone RE63575 Report

Search the DGRC for RE63575

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:635
Well:75
Vector:pFlc-1
Associated Gene/TranscriptGstT1-RA
Protein status:RE63575.pep: gold
Preliminary Size:1182
Sequenced Size:1011

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30000 2001-12-13 Blastp of sequenced clone
CG12930 2002-01-01 Sim4 clustering to Release 2
CG30000 2003-01-01 Sim4 clustering to Release 3
CG30000 2008-04-29 Release 5.5 accounting
CG30000 2008-08-15 Release 5.9 accounting
CG30000 2008-12-18 5.12 accounting

Clone Sequence Records

RE63575.complete Sequence

1011 bp (1011 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070580

> RE63575.complete
GCTTTGAGCTTTTTGACATTTCATCAGCGACAACAAATATATTTTGTTTT
CGTGTTTACCGGGCTTCCTGAAGCTAACTGATTAATTAATTGCCAAGATG
TCGAAGGCTATTAAGTATTATTACGATTTCCTATCGCAGCCATCCCGCGC
CCTCTGGATTGCTATGAAATTGGGCAAGACCCCATTTGAAGACTGCCCGG
TTGCCCTGCGAAAACAGGAGCAATTGACCGACGAATATCGCAGTATAAAT
CGGTTCCAAAAGGTGCCGGCCATCGTGGATGGTAAATTTCAGTTGGGCGA
GAGTGTCTCCATAGTGCGATATCTCGCGGACAAGGGAGTCTTCAGTGAAC
AGCTGTACCCCAAAACCTTGGAGGAACGCGCGCGGGTGGACGAGTTCCTC
GAGTGGCAGCATTTCAATGTCCGCTTGGTCTGCTCCCTGTTCTTCCGTCA
GGTGTGGCTTCTTCCGGCAAAGGGACTGGCGCCGGCTCCCAAGCCAGAGT
CTGTCAAGAAGCTAATCAAGGATGTGGAGAGTAATTTGGGTCTACTGGAA
CGCCTCTGGCTGGAAAAGGACTTCTTAGTCGGCGACAAACTTACCGTGGC
AGACATCTTCGGGTCTTCAGAAATTAATCAGATGAAGCTCTGCCAGTACA
ACGTAAATGAGAAGCAATTCCCCAAGGTGGCCAAGTGGATGGAACGCGTT
CGTGATGCTACCAATCCCTACTACGATGAGGCCCACAGCTTCGTCTACAA
GACCTCTCAGCAGGCAGTCAAGGCCAAAAACTGATTTCTTTTCGATTTTG
ACTGATTTCTTTGTTCATTGCATTTATTAGGATTTTAAAACATTTTTGTG
CCTTATCTGATGTTTATTGTGTTCAGTTCTGCGCTGCAAAACTCCTAAAT
GTTAAAATAATTAGAGACTATGAAAAGGGGTGATATCGGATCAATAATAG
TTTCATATGTTCGCTTTATATAATATAACTATCTTTGAAGTTGAGAAAAA
AAAAAAAAAAA

RE63575.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG30000-RA 1119 CG30000-RA 71..1063 1..993 4965 100 Plus
CG30005-RA 964 CG30005-RA 588..754 533..699 250 76.6 Plus
CG30005-RA 964 CG30005-RA 249..289 194..234 145 90.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:27:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5494319..5494676 636..993 1745 99.2 Plus
chr2R 21145070 chr2R 5493940..5494257 318..635 1575 99.7 Plus
chr2R 21145070 chr2R 5493488..5493702 1..215 1045 99.1 Plus
chr2R 21145070 chr2R 5493774..5493876 216..318 500 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:09:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9606825..9607182 636..993 1790 100 Plus
2R 25286936 2R 9606446..9606763 318..635 1590 100 Plus
2R 25286936 2R 9605990..9606204 1..215 1075 100 Plus
2R 25286936 2R 9606280..9606382 216..318 515 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9608024..9608381 636..993 1790 100 Plus
2R 25260384 2R 9607645..9607962 318..635 1590 100 Plus
2R 25260384 2R 9607189..9607403 1..215 1075 100 Plus
2R 25260384 2R 9607479..9607581 216..318 515 100 Plus
2R 25260384 2R 9609114..9609216 533..635 140 75.7 Plus
Blast to na_te.dros performed on 2019-03-15 14:27:55 has no hits.

RE63575.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:28:46 Download gff for RE63575.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5493488..5493702 1..215 99 -> Plus
chr2R 5493774..5493876 216..318 99 -> Plus
chr2R 5493941..5494257 319..635 99 -> Plus
chr2R 5494319..5494677 636..995 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:29:57 Download gff for RE63575.complete
Subject Subject Range Query Range Percent Splice Strand
CG30000-RA 1..687 98..784 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:17:19 Download gff for RE63575.complete
Subject Subject Range Query Range Percent Splice Strand
CG30000-RA 1..687 98..784 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:29:47 Download gff for RE63575.complete
Subject Subject Range Query Range Percent Splice Strand
GstT1-RA 1..687 98..784 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:43:24 Download gff for RE63575.complete
Subject Subject Range Query Range Percent Splice Strand
CG30000-RA 1..687 98..784 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:59:20 Download gff for RE63575.complete
Subject Subject Range Query Range Percent Splice Strand
GstT1-RA 1..687 98..784 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:49:54 Download gff for RE63575.complete
Subject Subject Range Query Range Percent Splice Strand
CG30000-RA 1..989 1..989 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:17:19 Download gff for RE63575.complete
Subject Subject Range Query Range Percent Splice Strand
CG30000-RA 1..994 1..995 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:29:47 Download gff for RE63575.complete
Subject Subject Range Query Range Percent Splice Strand
GstT1-RA 3..996 1..995 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:43:24 Download gff for RE63575.complete
Subject Subject Range Query Range Percent Splice Strand
CG30000-RA 1..989 1..989 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:59:20 Download gff for RE63575.complete
Subject Subject Range Query Range Percent Splice Strand
GstT1-RA 3..996 1..995 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:28:46 Download gff for RE63575.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9605990..9606204 1..215 100 -> Plus
2R 9606280..9606382 216..318 100 -> Plus
2R 9606447..9606763 319..635 100 -> Plus
2R 9606825..9607183 636..995 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:28:46 Download gff for RE63575.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9605990..9606204 1..215 100 -> Plus
2R 9606280..9606382 216..318 100 -> Plus
2R 9606447..9606763 319..635 100 -> Plus
2R 9606825..9607183 636..995 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:28:46 Download gff for RE63575.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9605990..9606204 1..215 100 -> Plus
2R 9606280..9606382 216..318 100 -> Plus
2R 9606447..9606763 319..635 100 -> Plus
2R 9606825..9607183 636..995 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:29:47 Download gff for RE63575.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5493495..5493709 1..215 100 -> Plus
arm_2R 5493785..5493887 216..318 100 -> Plus
arm_2R 5493952..5494268 319..635 100 -> Plus
arm_2R 5494330..5494688 636..995 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:19:33 Download gff for RE63575.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9607189..9607403 1..215 100 -> Plus
2R 9607479..9607581 216..318 100 -> Plus
2R 9607646..9607962 319..635 100 -> Plus
2R 9608024..9608382 636..995 99   Plus

RE63575.pep Sequence

Translation from 97 to 783

> RE63575.pep
MSKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSI
NRFQKVPAIVDGKFQLGESVSIVRYLADKGVFSEQLYPKTLEERARVDEF
LEWQHFNVRLVCSLFFRQVWLLPAKGLAPAPKPESVKKLIKDVESNLGLL
ERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPKVAKWMER
VRDATNPYYDEAHSFVYKTSQQAVKAKN*

RE63575.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:34:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12484-PA 228 GF12484-PA 1..227 1..227 1072 85.5 Plus
Dana\GF12486-PA 226 GF12486-PA 1..223 1..223 921 74 Plus
Dana\GF12485-PA 228 GF12485-PA 1..227 1..227 806 63.4 Plus
Dana\GF15963-PA 269 GF15963-PA 42..268 1..227 620 51.5 Plus
Dana\GF22526-PA 235 GF22526-PA 1..211 1..211 396 39 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24094-PA 228 GG24094-PA 1..228 1..228 1169 95.2 Plus
Dere\GG24095-PA 228 GG24095-PA 1..227 1..227 863 66.1 Plus
Dere\GG19687-PA 268 GG19687-PA 41..267 1..227 609 51.1 Plus
Dere\GG17782-PA 237 GG17782-PA 1..211 1..211 404 39.4 Plus
Dere\GG21886-PA 222 GG21886-PA 12..217 13..228 216 28.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22936-PA 228 GH22936-PA 1..227 1..227 903 70.5 Plus
Dgri\GH17734-PA 261 GH17734-PA 37..260 4..227 580 48.2 Plus
Dgri\GH12904-PA 239 GH12904-PA 1..209 1..209 366 37 Plus
Dgri\GH21542-PA 224 GH21542-PA 7..202 8..213 215 32.1 Plus
Dgri\GH13568-PA 220 GH13568-PA 1..214 1..227 214 28.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
GstT1-PA 228 CG30000-PA 1..228 1..228 1190 100 Plus
GstT2-PA 228 CG30005-PA 1..227 1..227 828 65.6 Plus
GstT3-PC 228 CG1702-PC 1..227 1..227 593 51.1 Plus
GstT3-PA 228 CG1702-PA 1..227 1..227 593 51.1 Plus
GstT3-PB 268 CG1702-PB 41..267 1..227 593 51.1 Plus
GstT4-PA 237 CG1681-PA 1..211 1..211 393 39.4 Plus
GstE4-PA 222 CG17525-PA 1..217 1..228 210 27.2 Plus
GstE12-PC 223 CG16936-PC 7..216 8..227 198 29.9 Plus
GstE12-PB 223 CG16936-PB 7..216 8..227 198 29.9 Plus
GstE12-PD 223 CG16936-PD 7..216 8..227 198 29.9 Plus
GstE12-PA 223 CG16936-PA 7..216 8..227 198 29.9 Plus
GstE5-PA 222 CG17527-PA 12..217 13..228 196 28.3 Plus
GstE7-PA 223 CG17531-PA 1..217 1..228 196 26.3 Plus
GstE3-PA 220 CG17524-PA 12..201 13..213 184 29.1 Plus
GstE1-PA 224 CG5164-PA 3..201 2..211 184 28.1 Plus
GstD8-PA 212 CG4421-PA 3..195 7..211 177 25.9 Plus
GstE2-PA 221 CG17523-PA 1..200 1..211 177 27.8 Plus
GstE10-PB 240 CG17522-PB 12..201 13..211 177 25.6 Plus
GstE10-PA 240 CG17522-PA 12..201 13..211 177 25.6 Plus
GstE13-PB 226 CG11784-PB 7..192 8..201 170 26.7 Plus
GstE13-PA 226 CG11784-PA 7..192 8..201 170 26.7 Plus
GstD1-PB 209 CG10045-PB 2..196 5..211 165 26.9 Plus
GstD1-PA 209 CG10045-PA 2..196 5..211 165 26.9 Plus
GstD4-PA 215 CG11512-PA 3..212 7..226 161 25.2 Plus
GstE8-PB 222 CG17533-PB 1..201 1..212 155 29.1 Plus
GstE8-PA 222 CG17533-PA 1..201 1..212 155 29.1 Plus
GstE6-PA 222 CG17530-PA 12..202 13..213 155 25.5 Plus
GstD3-PA 199 CG4381-PA 19..179 39..211 152 24.9 Plus
GstD9-PB 218 CG10091-PB 2..190 5..202 148 23.2 Plus
GstD9-PA 218 CG10091-PA 2..190 5..202 148 23.2 Plus
GstD6-PA 215 CG4423-PA 4..195 9..211 146 26 Plus
GstD11-PA 222 CG17639-PA 1..216 1..227 146 24.6 Plus
GstD11-PB 243 CG17639-PB 22..237 1..227 146 24.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18422-PA 226 GI18422-PA 1..225 1..225 801 64.9 Plus
Dmoj\GI15481-PA 269 GI15481-PA 45..268 4..227 608 51.3 Plus
Dmoj\GI14608-PA 237 GI14608-PA 4..210 5..211 399 40.2 Plus
Dmoj\GI19515-PA 223 GI19515-PA 7..198 8..209 207 30.5 Plus
Dmoj\GI16623-PA 219 GI16623-PA 1..202 1..214 202 27.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17152-PA 228 GL17152-PA 1..227 1..227 998 78 Plus
Dper\GL15796-PA 269 GL15796-PA 46..268 5..227 587 50.2 Plus
Dper\GL17151-PA 111 GL17151-PA 1..110 1..110 458 74.5 Plus
Dper\GL26929-PA 163 GL26929-PA 62..161 67..171 304 50.5 Plus
Dper\GL17771-PA 221 GL17771-PA 12..216 13..228 212 29.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15569-PA 228 GA15569-PA 1..227 1..227 999 78 Plus
Dpse\GA24982-PA 228 GA24982-PA 1..227 1..227 954 74 Plus
Dpse\GA23260-PA 269 GA23260-PA 46..268 5..227 587 50.2 Plus
Dpse\GA14161-PA 240 GA14161-PA 1..214 1..214 413 38.9 Plus
Dpse\GA14226-PA 223 GA14226-PA 7..203 8..214 210 31.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21142-PA 228 GM21142-PA 1..228 1..228 1195 97.8 Plus
Dsec\GM21143-PA 228 GM21143-PA 1..227 1..227 866 67 Plus
Dsec\GM11633-PA 237 GM11633-PA 1..211 1..211 398 39 Plus
Dsec\GM21879-PA 222 GM21879-PA 12..203 13..214 206 28.3 Plus
Dsec\GM11796-PA 223 GM11796-PA 7..203 8..214 201 30.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10672-PA 228 GD10672-PA 1..228 1..228 1192 97.4 Plus
Dsim\GD10673-PA 228 GD10673-PA 1..227 1..227 864 67 Plus
Dsim\GD17492-PA 249 GD17492-PA 41..248 1..227 551 47.6 Plus
Dsim\GD17126-PA 288 GD17126-PA 1..262 1..211 342 31.8 Plus
Dsim\GD11371-PA 219 GD11371-PA 1..201 1..214 202 31.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21509-PA 228 GJ21509-PA 1..227 1..227 870 69.2 Plus
Dvir\GJ19193-PA 270 GJ19193-PA 43..269 1..227 597 50.2 Plus
Dvir\GJ19422-PA 237 GJ19422-PA 1..213 1..213 410 39.5 Plus
Dvir\GJ19891-PA 222 GJ19891-PA 12..217 13..228 203 27.9 Plus
Dvir\GJ21084-PA 223 GJ21084-PA 7..202 8..213 197 30.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15954-PA 228 GK15954-PA 1..227 1..227 890 68.3 Plus
Dwil\GK15953-PA 228 GK15953-PA 1..227 1..227 823 65.6 Plus
Dwil\GK19806-PA 293 GK19806-PA 70..292 5..227 599 51.1 Plus
Dwil\GK25235-PA 236 GK25235-PA 1..224 1..228 385 36.5 Plus
Dwil\GK22983-PA 222 GK22983-PA 12..217 13..228 220 29.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:34:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19294-PA 228 GE19294-PA 1..228 1..228 1167 94.7 Plus
Dyak\GE19295-PA 228 GE19295-PA 1..227 1..227 810 67 Plus
Dyak\GE17886-PA 268 GE17886-PA 41..267 1..227 610 51.1 Plus
Dyak\GE17075-PA 234 GE17075-PA 1..211 1..211 406 39.4 Plus
Dyak\GE11961-PA 222 GE11961-PA 12..217 13..228 216 27.9 Plus

RE63575.hyp Sequence

Translation from 97 to 783

> RE63575.hyp
MSKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSI
NRFQKVPAIVDGKFQLGESVSIVRYLADKGVFSEQLYPKTLEERARVDEF
LEWQHFNVRLVCSLFFRQVWLLPAKGLAPAPKPESVKKLIKDVESNLGLL
ERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPKVAKWMER
VRDATNPYYDEAHSFVYKTSQQAVKAKN*

RE63575.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
GstT1-PA 228 CG30000-PA 1..228 1..228 1190 100 Plus
GstT2-PA 228 CG30005-PA 1..227 1..227 828 65.6 Plus
GstT3-PC 228 CG1702-PC 1..227 1..227 593 51.1 Plus
GstT3-PA 228 CG1702-PA 1..227 1..227 593 51.1 Plus
GstT3-PB 268 CG1702-PB 41..267 1..227 593 51.1 Plus